Sh_001B04_p000020

Overview
NameSh_001B04_p000020
Unique NameSh_001B04_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length316
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR016040
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001B04contigSh_001B04:14122..16177
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001B04_t000020Sh_001B04_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001B04_p000020 ID=Sh_001B04_p000020|Name=Sh_001B04_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=316bp
MADSAASRPTVLVTGAGGRTGQIVYNKLKERSEKFVARGLVRTEESKQKI
GGASDVYIADIRDADRLAPAVQGVDALIILTSAVPKMKPGFDPSKGGRPE
FYYEDGMYPEQVDWIGQKNQIDAAKAAGVKHIVLVGSMGGTNPNHPLNSL
GNGNILVWKRKAEQYLADSGVPYTIIRPGGLQDKDGGVRELIVGKDDELL
QTDTKSIPRADVAEALQYEEAKFKAFDLASKPEGVGHANKGLPGTVLPGH
CSVLSELLRSLLQVLDFMVSGDITRELEHGAAVWCNCKAVLKLKKEIGAL
FAVHCQMSSCRCVNC*
back to top