Sh_001B04_p000050

Overview
NameSh_001B04_p000050
Unique NameSh_001B04_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length417
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR003690
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001B04contigSh_001B04:51215..52465
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001B04_t000050Sh_001B04_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001B04_p000050 ID=Sh_001B04_p000050|Name=Sh_001B04_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=417bp
MPDAHSPTDGPSAAGGRPCAAAMVRLRNSLVPLLRAASPLPSPTRACRLL
SASTAIAPAPFSLEDYLVASCGLAPAQAREVSKRRSATYPEHTADHRMSS
PPPASTPPPTPMLSSPCSPAPASPATTLPCVVSADPLILRASVKNIAPRL
VALRDRLGLSTPQIARFLLVGSRALRDCDVIPRLEFFISFYGSFEQVLVA
AKRCMALLTSSTERLIKPNIALLRQWGVRDVAQLCTDNAWVLTFKAERVK
EFLLQAQELGVPPTSRMFRPVVATISRNSKDKVATKLEFYKRTLGVSESE
VSTAVSKMPAILGFSDEILLRKIKFLVNEAALEPRYIVERPVLFALNLEK
RLVPRHYVTKVLREKGLLNSDMSFYSVVALGEDTFKSKFIDRHKDSVPGL
ADTYAAARAGVVPSRI*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003690double-stranded DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated