Sh_001B04_p000060

Overview
NameSh_001B04_p000060
Unique NameSh_001B04_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length269
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001623
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001B04contigSh_001B04:52758..54081
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001B04_t000060Sh_001B04_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001B04_p000060 ID=Sh_001B04_p000060|Name=Sh_001B04_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=269bp
MALQLQAAAPYPPLPLASSRGHLAAPRPPPPFVSIAVAAASSPGPSARLS
CRGPAPRWRRASVRARAGAAGGGRRESPYEVLGVSPSAAPNEIKRAYRRL
ALKYHPDVNKEPDAQEKFLRIKHAYSTLMNSESRSKYASSSSDSSWSSSS
RESKSAAAEEPFYGFADFLKDLQAEFQNWEAGLNSNQKPKSLWEELAAIG
EEFVEFLENELKIDDSSPEDVTGNDPYTQSGQQAKNARDDKTSTNSFDDG
LSEIEAALEKLKKELGLG*
back to top