Sh_001B04_p000070

Overview
NameSh_001B04_p000070
Unique NameSh_001B04_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length351
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001B04contigSh_001B04:56403..57455
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001B04_t000070Sh_001B04_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001B04_p000070 ID=Sh_001B04_p000070|Name=Sh_001B04_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=351bp
MLRLRNRFLPLLRTASSLPSPIQPRACHLLLSTSTTFPRTFSLEDYLVAT
CGLAPTQAREVSKKLSRELLSTGSRRSLDELSFSRLNSASNPDAIIALLA
GAGLSRPDIAAAVSVDPLLLRALVKNIAPRILALRDCIGLSSPQIASFLL
VGSHALREGNVTPRLEFFISFYGSFDRVLVAAKRTRALLTMSLERIIKPN
IALFRQGGVPDVAKVCLKNPWVLTFKPERVKEFMLWAEELGVPATSPLFR
QAVAIVTSVSSEKVAAKLEFVKRTLGCSESEVSIAVSKMPCILGLSDVTL
LRKIEFLINEAAMEPQYIIKRPILLTFSLEKRLVAPASCHESAAGKGIVE
*
back to top