Sh_001B04_t000060

Overview
NameSh_001B04_t000060
Unique NameSh_001B04_t000060
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length807
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteHeat shock protein
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001B04contigSh_001B04:52758..54462
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_001B04_g000060Sh_001B04_g000060R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_001B04_p000060Sh_001B04_p000060R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_001B04_t000060 ID=Sh_001B04_t000060|Name=Sh_001B04_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=807bp
ATGGCGCTACAGCTGCAGGCCGCCGCTCCGTATCCTCCCCTGCCACTCGC
CTCCTCCCGCGGCCACCTCGCTGCGCCTCGGCCTCCGCCTCCCTTCGTCA
GCATAGCTGTCGCCGCCGCCTCCAGCCCGGGCCCCTCCGCGCGCCTCTCC
TGCCGCGGCCCGGCGCCTCGCTGGCGGCGTGCGAGCGTGAGGGCGCGCGC
CGGTGCCGCCGGCGGCGGGAGGCGGGAGTCCCCGTACGAGGTGCTCGGCG
TGTCGCCGTCGGCGGCGCCCAACGAGATCAAGCGCGCGTACCGGCGCCTC
GCGCTCAAGTACCACCCGGACGTCAACAAGGAGCCCGATGCTCAGGAGAA
GTTTCTGCGGATCAAGCACGCTTACAGCACTCTGATGAACTCAGAGTCTC
GATCCAAGTACGCGAGCAGCAGTTCAGATTCGTCCTGGTCCTCCAGCTCC
CGGGAGAGCAAATCAGCTGCTGCAGAAGAGCCGTTCTATGGATTTGCGGA
TTTCCTTAAAGATCTACAAGCAGAATTCCAGAACTGGGAAGCTGGGTTGA
ATTCAAATCAGAAACCTAAAAGCCTTTGGGAAGAGTTAGCTGCAATTGGT
GAGGAATTCGTAGAATTTCTGGAAAATGAATTGAAGATTGATGACTCCAG
CCCTGAGGACGTCACTGGAAATGACCCATACACCCAGTCTGGCCAGCAGG
CAAAAAATGCTAGGGACGACAAGACATCAACAAACAGCTTTGATGATGGT
CTTTCTGAAATAGAGGCCGCTCTCGAGAAGCTGAAGAAGGAACTTGGACT
GGGCTAA
back to top

protein sequence of Sh_001B04_p000060

>Sh_001B04_p000060 ID=Sh_001B04_p000060|Name=Sh_001B04_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=269bp
MALQLQAAAPYPPLPLASSRGHLAAPRPPPPFVSIAVAAASSPGPSARLS
CRGPAPRWRRASVRARAGAAGGGRRESPYEVLGVSPSAAPNEIKRAYRRL
ALKYHPDVNKEPDAQEKFLRIKHAYSTLMNSESRSKYASSSSDSSWSSSS
RESKSAAAEEPFYGFADFLKDLQAEFQNWEAGLNSNQKPKSLWEELAAIG
EEFVEFLENELKIDDSSPEDVTGNDPYTQSGQQAKNARDDKTSTNSFDDG
LSEIEAALEKLKKELGLG*
back to top

mRNA from alignment at Sh_001B04:52758..54462+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_001B04_t000060 ID=Sh_001B04_t000060|Name=Sh_001B04_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=1705bp|location=Sequence derived from alignment at Sh_001B04:52758..54462+ (R570 Sugarcane cultivar)
ATGGCGCTACAGCTGCAGGCCGCCGCTCCGTATCCTCCCCTGCCACTCGC CTCCTCCCGCGGCCACCTCGCTGCGCCTCGGCCTCCGCCTCCCTTCGTCA GCATAGCTGTCGCCGCCGCCTCCAGCCCGGGCCCCTCCGCGCGCCTCTCC TGCCGCGGCCCGGCGCCTCGCTGGCGGCGTGCGAGCGTGAGGGCGCGCGC CGGTGCCGCCGGCGGCGGGAGGCGGGAGTCCCCGTACGAGGTGCTCGGCG TGTCGCCGTCGGCGGCGCCCAACGAGATCAAGCGCGCGTACCGGCGCCTC GCGCTCAAGTACCACCCGGACGTCAACAAGGAGGTGCGTGTGGCGACCGA CCCCTGCTGCTTGCTCGCGCTCTTTACTTTCGCGTTCTGTTTGATCTCTA CGGGATTTCTTAGGACGTTGGGGATGGATGGCTCTGCTCACCGACAGCCT CGTGGATTGGATGTTGTCAATGCAGCCCGATGCTCAGGAGAAGTTTCTGC GGATCAAGCACGCTTACAGCACTCTGATGAACTCAGAGTCTCGATCCAAG TACGCGAGCAGCAGTTCAGATTCGTCCTGGTCCTCCAGCTCCCGGGAGAG CAAATCAGCTGCTGCAGAAGAGCCGTTCTATGGATTTGGTACTGAATTAT CCCCTTGCTGTCAGTAAACGTGGGTTACATTACATATGGTTGATCGTTGA TGTGACCAAAGGGGTCAAGTGAGGTTCCATTGTTCTACTGGAAATTTGAG ACCTTAGTGATTGTCATGTGGAGATATAAGGCTTTCTAGTGCAGTTCACC AAAATGTCTTCACCTCTACTGTGACTTTAAGACTATAGTGATTGTGCTTT TTGCAGCGGATTTCCTTAAAGATCTACAAGCAGAATTCCAGAACTGGGAA GCTGGGTTGAATTCAAATCAGAAACCTAAAAGCCTTTGGGAAGAGTTAGC TGTAAGTTATCTTTATTCAACATTTCAACTATTTTGATTATTGTGAGTTT GTGTCCCTGTTAAGAATTGCCATGCAGCAATATAGCATAGATAAGGCCAG CTATTATAGTTTTCTGGAGAATGCCATGTGAACCCTGCACTGCGTTCTGC TCAATCAGGCAATTGGTGAGGAATTCGTAGAATTTCTGGAAAATGAATTG AAGATTGATGACTCCAGCCCTGAGGACGTCACTGGAAATGACCCATACAC CCAGTCTGGCCAGCAGGCAAAAAATGCTAGGGACGACAAGACATCAACAA ACAGCTTTGATGATGGTCTTTCTGAAATAGAGGCCGCTCTCGAGAAGCTG AAGAAGGAACTTGGACTGGGCTAAACCGTTGATGTGGCAACTAAAGGTGT TGCTGTTGCTACTGACTTAATGTTCATACAGAGGTATTTCTTGTAATGTA TGTAACAGTTGGTGATAATAATTAGCAGTTGTGATCTATCGCGTTCGTTT CATTTTGTCTTTTCTAAATACAAGGCATAGTATATATATCTAGAAGGATA GCAAAAACTATGTGTCTAGAAAGGCAAAACAACCTATAATTTGGGATGGA GAGAATAATCGATAGTCAAGAGCTTATTTTTTACCTCTAATTGTTCAGCA TATTTGGGTAAAGGCGTTCTGATTTTTTGTGTGATAGGGGTACAAAAGAA AAGGTTGTGCACTGATAGCACAATTTATGGTTGTTTTCTCTGTCGAATAC AATTT
back to top

Coding sequence (CDS) from alignment at Sh_001B04:52758..54462+

>Sh_001B04_t000060 ID=Sh_001B04_t000060|Name=Sh_001B04_t000060|organism=R570 Sugarcane cultivar|type=CDS|length=807bp|location=Sequence derived from alignment at Sh_001B04:52758..54462+ (R570 Sugarcane cultivar)
ATGGCGCTACAGCTGCAGGCCGCCGCTCCGTATCCTCCCCTGCCACTCGC
CTCCTCCCGCGGCCACCTCGCTGCGCCTCGGCCTCCGCCTCCCTTCGTCA
GCATAGCTGTCGCCGCCGCCTCCAGCCCGGGCCCCTCCGCGCGCCTCTCC
TGCCGCGGCCCGGCGCCTCGCTGGCGGCGTGCGAGCGTGAGGGCGCGCGC
CGGTGCCGCCGGCGGCGGGAGGCGGGAGTCCCCGTACGAGGTGCTCGGCG
TGTCGCCGTCGGCGGCGCCCAACGAGATCAAGCGCGCGTACCGGCGCCTC
GCGCTCAAGTACCACCCGGACGTCAACAAGGAGCCCGATGCTCAGGAGAA
GTTTCTGCGGATCAAGCACGCTTACAGCACTCTGATGAACTCAGAGTCTC
GATCCAAGTACGCGAGCAGCAGTTCAGATTCGTCCTGGTCCTCCAGCTCC
CGGGAGAGCAAATCAGCTGCTGCAGAAGAGCCGTTCTATGGATTTGCGGA
TTTCCTTAAAGATCTACAAGCAGAATTCCAGAACTGGGAAGCTGGGTTGA
ATTCAAATCAGAAACCTAAAAGCCTTTGGGAAGAGTTAGCTGCAATTGGT
GAGGAATTCGTAGAATTTCTGGAAAATGAATTGAAGATTGATGACTCCAG
CCCTGAGGACGTCACTGGAAATGACCCATACACCCAGTCTGGCCAGCAGG
CAAAAAATGCTAGGGACGACAAGACATCAACAAACAGCTTTGATGATGGT
CTTTCTGAAATAGAGGCCGCTCTCGAGAAGCTGAAGAAGGAACTTGGACT
GGGCTAA
back to top