Sh_001B06_p000020

Overview
NameSh_001B06_p000020
Unique NameSh_001B06_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length405
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR021099
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001B06contigSh_001B06:4899..6113
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001B06_t000020Sh_001B06_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001B06_p000020 ID=Sh_001B06_p000020|Name=Sh_001B06_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=405bp
MAHRLFCATRALLLPAPAPTPTSASSAAAAEAAASLLPLLPCKRRKKLLR
KLNSPRVAPIEPEAARRVPALDAVLDRDTAFRFLHRARSFLASLPPPHRI
PLSEAGKLYRELGFPRGRKVSRSATRHPLMFHLPVVDSVPHLALTPFMCS
LLEEERRIHDDLLPSRVRAVRKLLMLTAHSRVPLAKLHHCRAVLGLPDDF
RDRVHDFPDDFRVVVDPRDGRHILELARWDPALAVSALERDFVVDERRVR
RTFRFAVPHRRLMPLDAEDADRLDTVTTFPLVSPYTNGALLKPWTPEAEK
YRVGVVHEFLSLTLEKRAMIHHIVEFKEEFGLTRHMYESLQKQNRAFYLA
GTEMNWALFLRAAYDENGVLKEKDPLVLFNEKLQRYACMSKMDSRENMID
AAGL*
back to top