Sh_001B06_p000030

Overview
NameSh_001B06_p000030
Unique NameSh_001B06_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length209
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001B06contigSh_001B06:17865..18783
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001B06_t000030Sh_001B06_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001B06_p000030 ID=Sh_001B06_p000030|Name=Sh_001B06_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=209bp
MDYRWKYLEHCIASKCFPPGFGSNRREDERAPVLFSACKSRSENKNAFFE
VELLRCSEEVLACFTGDNAEECNSNESGWTMYLGSPVNSDDLKANGSKGS
NVGSGCSNGRSKNDSMDYDDRDYDSLASDASTGPAQVKELNGKEKKFHEK
RDNSIHEQDSDKQDEIHTKLPNNCDKKAGKMKKGEEKTTKRGHNKRRSSC
SSRTSFFR*
back to top