Sh_001B06_p000040

Overview
NameSh_001B06_p000040
Unique NameSh_001B06_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length157
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001B06contigSh_001B06:26363..26833
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001B06_t000040Sh_001B06_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001B06_p000040 ID=Sh_001B06_p000040|Name=Sh_001B06_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=157bp
MLKSTHFGHSSQGQIHVLEYIVECIHRAKIQPDPSTIWYTFCAYEEHELY
NTAIEALLVLSMRMISEDVSILSEKRIVFEDLILSEEPDAELRIIRAFQA
GEEFLATALLNLRWCATMGATISWSPEESLWARRLASSYDANKRPHINPS
DVPKSW*
back to top