Sh_001B06_p000060

Overview
NameSh_001B06_p000060
Unique NameSh_001B06_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1618
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001878
InterProIPR025724
InterProIPR012337
InterProIPR013103
InterProIPR001584
InterProIPR025314
InterProIPR000095
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001B06contigSh_001B06:34635..39488
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001B06_t000060Sh_001B06_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001B06_p000060 ID=Sh_001B06_p000060|Name=Sh_001B06_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=1618bp
MSAGQSQGSVASSARRRQEADLAAAEKRERAAADAAAAAARASRLAAAEL
AAARAEVEAAAAADAARAAAAEVEVLRGSNSSSIAADDSADADLELLERE
ASRGRAAQWAAVHAHERGGSPDRRRHAGGAPEGGAHGGGAPGGGAHGGGG
RVDGERGLHRQRGSLSPVRYRGHHEYQAVVRDVGLGGGWPTLTKTNYVEW
AAVMRVKLQVRHMWDAVRYGDVDYDQDRRALDALIAAVPPEMQFSLTSKR
TAKEAWDAIAAARIGSDRARKSTLQALRKEWENLAFKPGEDVDDFALRLN
TLLQKLVQFGDDTYGEERAVEKLFRCVPEKYKQMARSIESLLDLSTMTIE
EALGRLKVVDSDEPQRLSGPVTIGGKLLLTREQWAAGQGDRKKGESSSTT
GGRKRGKRGKPRKDAQAGARGRAEGDDRGGAQGGAAGKQKPARGDPCYNC
GKLGHWAKDCRQPRRGQAHVAQAEEEEQPALFIAHASIELPPAAPAATAL
LHLDEPKAHALLDDSSGNDKADGWCLDTGATHHMTGRREFFTELDPSVRG
TVKFGDASAVEIKGVGSVVFVAKTGEHRLLTGVYYIPALRNSIISLGQLD
ESGSRVEIEHGVLRIWDHRHRLLVKVNRSNRLYVLHAQVAQPLCLAARRD
DDAWRWHERFGHLNFEALRQLGSKDMVRGMPHVDHVEQFCDTCVLTKLRR
LPFPRQASFRAKEKLELVHGDLCGPVTPATPGGRRYFLLLVDDMSRYMWA
VLLDAKAAAADAIKRLQAAAEAECGRKLRVLRTDNGGEFTAAEFAAYCAD
EGIHRHFSAPYTPQQNGVVERRNQTVVATARALLKQRGMPAIYWGEAVMT
AVHLLNRSPTKALDDKTPYEAWHGRKPAVSHLRVFGCLAFVKELNHVGKL
DDRSTPGVFIGYAEGSKAYRVLDPATRRVRITRDVVFDEGRSWTWGKMVD
DGSTPTTSDFVVDYVHFKEAGGASSSSSPSSPTPPPCSPPPPASPSPPPP
PAPASPQAPASPPPAPPATPRSPTLDPTSSGSAPAASAHDEQRTVEFATP
LSNDEDRIDAYHGGEPLRYRTVDNLLGEQPVPGLAQHDFEAELHLVQDDG
EPRSFAEAERDAAWRAAMQMEMDAVERNKTWELADLPAGHHAISLKWVFK
LKKDETGEVIKHKARLVARGFVQQEGIDFDDAFAPVARMESVRLLLALAA
QEGWRVHHMDVKSAFLNGDLKEEVYVHQPPGFVIPGKEGKVLRLRKALYG
LRQAPRAWNAKLDSTLKGMGFEQSPHEAAIYRRGSGGKALLVGVYVDDLV
ITGTKEVEIEAFKEKMRATFQMSDLGPLSFYLGIEVHQDSSGTSLRQTAY
AKRIVELGGLTDCNPAHTPMEERLRLSRESTEEEVDATQYRRIVGSLRYL
VHTRPDLAFAVGYVSRFMQRPTMEHQQAVKRILRYVAGTSDYGLHYPRCP
GAAHFIGYSDSDHAGDIDTSKSTSGTLFFLGKCPISWQSVKQQVVALSSC
EAEYIAATTAATQALWLARLLGDLLGRDAEAVELRVDSKSALALAKNPVF
HERSKHIRVRYHFIRSCLEEGSVRANYINTQDQLADFLTKSLGRVKFQEL
RARIGMAQIPHKEPHKT*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
Vocabulary: Biological Process
TermDefinition
GO:0015074DNA integration