Sh_001B06_p000110

Overview
NameSh_001B06_p000110
Unique NameSh_001B06_p000110
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length650
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002885
InterProIPR032867
InterProIPR011990
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001B06contigSh_001B06:112881..114830
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001B06_t000110Sh_001B06_t000110R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001B06_p000110 ID=Sh_001B06_p000110|Name=Sh_001B06_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=650bp
MGLHGRAFHLIRCAGATHGTYVGHVEAGHGGLLALLPPCRPGAIQEAARR
AQCSPAPRTPGTRSAARAMPPATVPFFVTSTTLATAAMKPQPQSPPCDAQ
AQAAQASAASASYAARMRLNPHLALRLFDHLLRSGADPDPAAYELAFASC
VRGRDRATAAQLHAHAAKRGLVASHRRVRCRLVHAYAVCGMLPHARRVFD
GGTDNDMVAWNCLLRGYAQEGGDAGLLHDFFARMPSRDSVSWNTVLSWCV
VNGKYDEAIAVFREMLASQECQPDRVTLVSVVSAIAYLGALAQGLWAHAY
VFRKGVEVEEKLSSALINMYSKCGFIEGAVYVFDNVRGKRSLDTWNAMLA
GFTANGCSERALELFTRMESTGLMPNKITFNCVLNACSHRGLVEEGMRCF
QRMSRVYGIEPDIAHYGCMVDLFCRAGMFEKAEKIIQIMPMEPDASMLKA
LLRACRTHKNLEVGKKAGHRLIEAAPNDHAGYVLLSNIYALDGNWGGVHK
VRKLMLDRGVLKTPGSSSVELNGVIHEFISGDKSHSRKRDIYKMLGEICQ
QLKSAGYTPDTSQVLLDIDDEDVKESSLALHSEKLAIAFGLISTAPGTPI
RVVNNLRICGDCHNAIKLLSKIYGRCIIVRDANRFHHFRKGSCSCGDYW*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding