Sh_001C11_p000030

Overview
NameSh_001C11_p000030
Unique NameSh_001C11_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length467
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002528
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_001C11contigSh_001C11:37205..46714
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_001C11_t000030Sh_001C11_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_001C11_p000030 ID=Sh_001C11_p000030|Name=Sh_001C11_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=467bp
MVAASVVEMRLLVRLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASL
GNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTILLMAT
GVPLAVIYAFSRPILVLLGESPAIASAAAVFVYGLIPQIFAYAANFPIQK
FMQAQSIMAPSAYISAATLVVHVGLSYLAVYQWGARPAGGVADPQSQLVG
HRRRAVRLHRHQRAVSTHVDGLLVGGVLGGSRASSSSRLPRLLCFALRRG
TSRYSCSSPDSSRILSLHYPHSLSGNMTLTGWVFMISVGFNAAASVRVSN
ELGAGNPKAASFSVVVVTLLSFVLSVLISIVILLCRDYISYIFTEGEDVS
RAVSKLTPLLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIP
LGCLLGFYFDLGAAGIWSGMIGGTFMQTLILVWVTYRTNWTKEVEEAQKR
LNKWNDSKAPLLSAQE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0015238drug transmembrane transporter activity
GO:0015297antiporter activity
Vocabulary: Biological Process
TermDefinition
GO:0006855drug transmembrane transport
GO:0055085transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane