Sh_002I04_p000110

Overview
NameSh_002I04_p000110
Unique NameSh_002I04_p000110
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length156
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I04contigSh_002I04:115544..116011
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I04_t000110Sh_002I04_t000110R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I04_p000110 ID=Sh_002I04_p000110|Name=Sh_002I04_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=156bp
MSTASPHPSPTASATPVLRTAARTTQTTPAPSSRHRLASASTGTRRSLTS
FGSSASTVWRTSPSTTASSSPTAASRSPASSAAVRSTALSTTSPPRCSSP
SSAGEPAAPRARTPGRHCASHHQCPRRRPTGCLGGTKEEPFTCVTLRKML
KLTCH*
back to top