Sh_002I04_p000120

Overview
NameSh_002I04_p000120
Unique NameSh_002I04_p000120
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length53
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I04contigSh_002I04:119092..119600
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I04_t000120Sh_002I04_t000120R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I04_p000120 ID=Sh_002I04_p000120|Name=Sh_002I04_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=53bp
MLIHCYPIHCLSLSRPKRGLVPTLLLPPWLVGRLCSYPRGGSKLQTVSKQ
EC*
back to top