Sh_002I04_t000120

Overview
NameSh_002I04_t000120
Unique NameSh_002I04_t000120
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length159
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteDoubtful hypothetical protein
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I04contigSh_002I04:118353..121327
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002I04_g000120Sh_002I04_g000120R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002I04_p000120Sh_002I04_p000120R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002I04_t000120 ID=Sh_002I04_t000120|Name=Sh_002I04_t000120|organism=R570 Sugarcane cultivar|type=mRNA|length=159bp
ATGTTAATCCATTGTTACCCGATCCACTGTCTGTCTTTATCTCGCCCCAA
AAGGGGCCTTGTTCCGACACTTCTACTCCCTCCATGGTTAGTCGGCCGGC
TTTGTAGTTATCCGCGTGGAGGCAGCAAGCTGCAAACCGTAAGCAAACAA
GAGTGCTGA
back to top

protein sequence of Sh_002I04_p000120

>Sh_002I04_p000120 ID=Sh_002I04_p000120|Name=Sh_002I04_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=53bp
MLIHCYPIHCLSLSRPKRGLVPTLLLPPWLVGRLCSYPRGGSKLQTVSKQ
EC*
back to top

mRNA from alignment at Sh_002I04:118353..121327-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002I04_t000120 ID=Sh_002I04_t000120|Name=Sh_002I04_t000120|organism=R570 Sugarcane cultivar|type=mRNA|length=2975bp|location=Sequence derived from alignment at Sh_002I04:118353..121327- (R570 Sugarcane cultivar)
TGCCCCTGCGACCCCGACGCGGCCGGCGGTGCGGGCGTGACGGCTCCGGC GACCTCAGAGCGCGCGACGAACGCAGGCACAGCGGGTACGACCACCCCGG CGCAGGCGTGGGGCTCGAGCTCTCCAGCCCCGGCTCCCCCTCCCAATCCG GTATGCCGCCGCACACTCGGAGGGCAGTGAGAATCCCTCTGTCGGAGTTC CAGGCAGCGCCGGATGTGTCCTACAACGAGTAGGAGGCCCTAAAGTACAC CTCCTCCTCCCGTATCATCGAAATCCAAGTGAGCAAGTGAAGCGCCTCCC CCATTTGATTTGAGCTTTGCCGATTTTTCGGCGCTGACGCGAAGTCACAT GCCTTCTTTCAGTCTAGGATTTTCGAGAAGGCGCTACAGCTGCTCGCTCT TCTCAACGATGGCGTCCCCAAGCTGCTTCTCGACATAGGTCAGCTTACTC TCTTCTACAGCTCTCCTTCATGAATCATGGCATATCGCGTTGGCTAGAAC AACATAAAGTATTCTGCTTTGATGGGGGCAAAAATACATGCTGTGAGACC TCTTAATTACAATCAGTTTTGGCAACCGAAAGATATCTATGTTTATAGAT ATGTTTACCTACGATGACTTTGTGTGCTGTGATTACCAGGATGTGGTTCT GGGCTTAGTGGTGAGACATTTGACGCAGCATGTCCACCACTGGATTGGCT ATGATATTTCAAAGTCGATGCTCGGTGAGGACCTCTCTATGTTCCTTTCT CTTGGCTTGTTTAGCACCAATTGGAAAGGGAAATGGGAGTTTAGAGGAGG GGAGCTTTCTAGATATCTTGCTCTGGTGCCTGCATCCTTTTTTAGAACTG GCAAATCTTCGTGCTTGTAGCGTGGCTATGAAGAACAGGATATCTCCGTG CTTTCTAGATATCTTAGAACTGATATTCTCCCAGTGAGTTTGGCAAATGA TCGTATTTCACGATTTTGCTTTCACCTTTTCACAGGAGACACCAGCTTTG GTAGCCTCTTGATTAATTTGATTAGCTGCAGATAATGATTCATTCCAGTG AGTATACACTTCCTTATAATTCTCAATGTGTGTTAGGTTTACTTGGATAT ATTATCACAACCAATTCCCCTATTTCTCAGTGCTAACTATGATTCAAAAT CTGGCATACTTAGGTGTGGTGTCATTTGTTATGTACAACTTGGAAGAAAT TGTTTATATGCAAGTTATCCTTATTGCAATTTGAATTAGATCGACTTATA GCTTGCCCCAGGTACATTCTCCTCCTCTGCTTAGAGAATGGGACTTTTTT AATGCCATGGTTCTGAGCGGAATTTATATAAAATATATATCTCATAAATC ATGATATAGATAGATAAATCTCATTATTCCTAAGTTCAATTCAATAGTTT CTGAAGCCAGTTTCTATAAACAAGTACGAGGATCTATGATTATGGGCATT CCTGCACAGAGATGTTTCTGTTCAAGAATATTCAGATTTCATATTAGTCA TATATCTTCTCAAACTTTCAAGATTACAAATACAAAATTTAATCAGCGAC TTAATCATTTTGCACAACTATTTTTCTACTTTTTGTGACAAATTCAGTTT GAAATAAAATAACACAAAAGCAAATAGAGAAGTATGGTCTGTTCTTTCCT CAGACTACAGCTTCATCTATTACCAAATACGTGCACAGTTCCACTACTCA ATTTTTTTCTATTTAAATGCAGCACATATGTTAATCCATTGTTACCCGAT CCACTGTCTGTCTTTATCTCGCCCCAAAAGGGGCCTTGTTCCGACACTTC TACTCCCTCCATGGTTAGTCGGCCGGCTTTGTAGTTATCCGCGTGGAGGC AGCAAGCTGCAAACCGTAAGGTGTGCGTTGTTTATCTTCACTCTTCTTTG CATCCTTGACTTGAATTTTAGAAGTTGCTTCTCTTCGATGCTGGCCTCAA CATCTGCGTTCGAATTAGATTAGCAGAAAATCTAGATACAAGATTTCAAA TTGAGAGCCATTTTTCTAGATAGAGAATTTCGAATTGAGACTTCTTACCA ATCTAATATATCCCTGCGTTTGCTATTGTAAGATTGGGTTAAACAAATCT AAAAATCCTAGATTACCAATGCAGTTTTTTAAGGTTGCTACCTCCTTGCA GTAGCCGCTTATTGGACACAATTTTAAAAAAGATAGTCATATAAGTTTAC ATTTGTTGTCTGTATTTCAGCAAACAAGAGTGCTGACACTATTGGTCCTT CCTTCCAAGTAACCATGATTAATCAGTTATACCACAGATGCAGGTTTGCG GCCTAACAAATATTCTACTTTGATTTAACGCAAATTATTATCCTCTTCTC CATGACCCCCTTTTTTTTCCTTATGCATTTGATGCAGTTGTATCATGATA GCTTTTTCACAAGGTTTCTAGCCACATGAAGTATTCAATAGATTAATAGA TATATTATTATTTTAGCGATATTGTGTGCCCAATATATCTACCGCCTCAA TAATAATATAGTATCTTTTAATTTCATAGATAACAATTTTATGCCTTTTC AACCAGTTGTAGTCGCAGTTCACCTCTTGGATTATTTTCTAATGATGTGC ACCTCTTTTCAGCTGTCAAATTGATCCATGCTTAGCTGTCCAATTGGTCC ACCCTGTCTGAACTGATATCTATTTTGCCTGCTCCAAGTGATGCTTAGCA ATTATCTACTACAGTCCTTATTTAGTTAAGTTTAGGTAAACCAGATATGA AAGAAGACATGCTAGATGGAGAGTATATTTGTCGCTTGGCTGATAAGTCA TGGCTGAATGTACTGTTCGCTGATTTATTGTGAGAGGAAAACACTGCTGA ATGGTTAGCTGATTTGGCTGATAAGCTCAAGCGAACAAGGCGTTAGTTGT TGATTGATTTGGATATAGTGCCCGTTCTCACTTTCTGCATTACAATGGAT CAGGAAGAAATAAAGCGAAGTTTCG
back to top

Coding sequence (CDS) from alignment at Sh_002I04:118353..121327-

>Sh_002I04_t000120 ID=Sh_002I04_t000120|Name=Sh_002I04_t000120|organism=R570 Sugarcane cultivar|type=CDS|length=159bp|location=Sequence derived from alignment at Sh_002I04:118353..121327- (R570 Sugarcane cultivar)
ATGTTAATCCATTGTTACCCGATCCACTGTCTGTCTTTATCTCGCCCCAA
AAGGGGCCTTGTTCCGACACTTCTACTCCCTCCATGGTTAGTCGGCCGGC
TTTGTAGTTATCCGCGTGGAGGCAGCAAGCTGCAAACCGTAAGCAAACAA
GAGTGCTGA
back to top