Sh_002I04_t000130

Overview
NameSh_002I04_t000130
Unique NameSh_002I04_t000130
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length819
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteConserved hypothetical protein
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I04contigSh_002I04:137009..137827
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002I04_g000130Sh_002I04_g000130R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002I04_p000130Sh_002I04_p000130R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002I04_t000130 ID=Sh_002I04_t000130|Name=Sh_002I04_t000130|organism=R570 Sugarcane cultivar|type=mRNA|length=819bp
ATGCATATGCCATGGGAGTGTCCTCTGGGTATGTCTTATTCTTATCCATC
TTGGAGTTATTATAATACATGGATGTCATATCCTCCTATGCACTATGAGG
ATTGGACTGCTCCAAGAAGACCCACAGGTGGAACATATTCTAATAGTGGC
CGTTTTGATCAAATAAATCAGTCTGGAGCTCATGGAGTGAAGAAAACGGT
AATCAAGCAAGTTTACTGTGTCAAAAAGGATGGTCGCAAAGCAGCTAGTT
TAGATCTGATTTCAAATGATAAAAGGCCGATCAAGGTGTTGGCGACATCG
GCTATTGATGGCAAAGAAGTGAAGCAAGCAATTGTTGATAACCAAGTTGC
CAAATCTGAATGTGGGATGTTGGAAGTGCCCAAGTTGAATAAAGAATTCC
CAACGCCAAAATCAAAATCAGAGCCGAGATGCCCACTCCGTTTATCAAGT
TGGCAAGGGAAGAATTTGCAAAGGCTCAGTGCAGAACAGCTGAAAAAGAA
GAATATGGCATTGGTTCCCAAAGGGACAAATCAAATTCAAGACATGGATA
ATGGTCGAGCATCCGTTCCGATGGAGGCAATGAGATCGAAGAAGAAGAAA
GGAGTCAAGAAACAAGTATTTAGCCAAAGGCTTGCATCGGATCATTATTA
TCTTGGGCCATCCTATCATCCATATTCCTTAGCCATGCCATTAGGACCAA
TGTCATGGAGTCTATCATCAAGTATGTTTGGTTACCCCTCTTGGTCCTAT
TGTGAGCCTTGGGTGCAATCATTATATCGTGGAGGGGTCCCACCAAATTA
TTACACATTGATTGATTGA
back to top

protein sequence of Sh_002I04_p000130

>Sh_002I04_p000130 ID=Sh_002I04_p000130|Name=Sh_002I04_p000130|organism=R570 Sugarcane cultivar|type=polypeptide|length=273bp
MHMPWECPLGMSYSYPSWSYYNTWMSYPPMHYEDWTAPRRPTGGTYSNSG
RFDQINQSGAHGVKKTVIKQVYCVKKDGRKAASLDLISNDKRPIKVLATS
AIDGKEVKQAIVDNQVAKSECGMLEVPKLNKEFPTPKSKSEPRCPLRLSS
WQGKNLQRLSAEQLKKKNMALVPKGTNQIQDMDNGRASVPMEAMRSKKKK
GVKKQVFSQRLASDHYYLGPSYHPYSLAMPLGPMSWSLSSSMFGYPSWSY
CEPWVQSLYRGGVPPNYYTLID*
back to top

mRNA from alignment at Sh_002I04:137009..137827+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002I04_t000130 ID=Sh_002I04_t000130|Name=Sh_002I04_t000130|organism=R570 Sugarcane cultivar|type=mRNA|length=819bp|location=Sequence derived from alignment at Sh_002I04:137009..137827+ (R570 Sugarcane cultivar)
ATGCATATGCCATGGGAGTGTCCTCTGGGTATGTCTTATTCTTATCCATC TTGGAGTTATTATAATACATGGATGTCATATCCTCCTATGCACTATGAGG ATTGGACTGCTCCAAGAAGACCCACAGGTGGAACATATTCTAATAGTGGC CGTTTTGATCAAATAAATCAGTCTGGAGCTCATGGAGTGAAGAAAACGGT AATCAAGCAAGTTTACTGTGTCAAAAAGGATGGTCGCAAAGCAGCTAGTT TAGATCTGATTTCAAATGATAAAAGGCCGATCAAGGTGTTGGCGACATCG GCTATTGATGGCAAAGAAGTGAAGCAAGCAATTGTTGATAACCAAGTTGC CAAATCTGAATGTGGGATGTTGGAAGTGCCCAAGTTGAATAAAGAATTCC CAACGCCAAAATCAAAATCAGAGCCGAGATGCCCACTCCGTTTATCAAGT TGGCAAGGGAAGAATTTGCAAAGGCTCAGTGCAGAACAGCTGAAAAAGAA GAATATGGCATTGGTTCCCAAAGGGACAAATCAAATTCAAGACATGGATA ATGGTCGAGCATCCGTTCCGATGGAGGCAATGAGATCGAAGAAGAAGAAA GGAGTCAAGAAACAAGTATTTAGCCAAAGGCTTGCATCGGATCATTATTA TCTTGGGCCATCCTATCATCCATATTCCTTAGCCATGCCATTAGGACCAA TGTCATGGAGTCTATCATCAAGTATGTTTGGTTACCCCTCTTGGTCCTAT TGTGAGCCTTGGGTGCAATCATTATATCGTGGAGGGGTCCCACCAAATTA TTACACATTGATTGATTGA
back to top

Coding sequence (CDS) from alignment at Sh_002I04:137009..137827+

>Sh_002I04_t000130 ID=Sh_002I04_t000130|Name=Sh_002I04_t000130|organism=R570 Sugarcane cultivar|type=CDS|length=819bp|location=Sequence derived from alignment at Sh_002I04:137009..137827+ (R570 Sugarcane cultivar)
ATGCATATGCCATGGGAGTGTCCTCTGGGTATGTCTTATTCTTATCCATC
TTGGAGTTATTATAATACATGGATGTCATATCCTCCTATGCACTATGAGG
ATTGGACTGCTCCAAGAAGACCCACAGGTGGAACATATTCTAATAGTGGC
CGTTTTGATCAAATAAATCAGTCTGGAGCTCATGGAGTGAAGAAAACGGT
AATCAAGCAAGTTTACTGTGTCAAAAAGGATGGTCGCAAAGCAGCTAGTT
TAGATCTGATTTCAAATGATAAAAGGCCGATCAAGGTGTTGGCGACATCG
GCTATTGATGGCAAAGAAGTGAAGCAAGCAATTGTTGATAACCAAGTTGC
CAAATCTGAATGTGGGATGTTGGAAGTGCCCAAGTTGAATAAAGAATTCC
CAACGCCAAAATCAAAATCAGAGCCGAGATGCCCACTCCGTTTATCAAGT
TGGCAAGGGAAGAATTTGCAAAGGCTCAGTGCAGAACAGCTGAAAAAGAA
GAATATGGCATTGGTTCCCAAAGGGACAAATCAAATTCAAGACATGGATA
ATGGTCGAGCATCCGTTCCGATGGAGGCAATGAGATCGAAGAAGAAGAAA
GGAGTCAAGAAACAAGTATTTAGCCAAAGGCTTGCATCGGATCATTATTA
TCTTGGGCCATCCTATCATCCATATTCCTTAGCCATGCCATTAGGACCAA
TGTCATGGAGTCTATCATCAAGTATGTTTGGTTACCCCTCTTGGTCCTAT
TGTGAGCCTTGGGTGCAATCATTATATCGTGGAGGGGTCCCACCAAATTA
TTACACATTGATTGATTGA
back to top