Sh_002I17_p000010

Overview
NameSh_002I17_p000010
Unique NameSh_002I17_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1109
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC3.6.4.12
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I17contigSh_002I17:3939..7404
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I17_t000010Sh_002I17_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I17_p000010 ID=Sh_002I17_p000010|Name=Sh_002I17_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=1109bp
MELAKLLDRVPIPVKESLEEPSAKINVLLQAYISRLKLEGLSLSSDMVYI
RQSAGRLLRALFEIVLKRGWAQLAEKALNLCKMVDKQMWSVQTPLRQFTG
IPKAILMKLEKKELAWERYYDLSSQEIGELIRYPRMGRQLHKCIHQLPKL
NLSAHVQPITRTVLGFELTITPDFQWDDKVHGYVEPFWVIVEDNDGEYIL
HHEYFMLKKQYVDEDHTLNFTVPIYEPLPPQYFIHVVSDKWLGSQTILPV
CLRHLILPEKYAPPTELLDLQPLPVSALRNARYEGLYSAFKHFNPIQTQV
FTVLYNSDDSVLVAAPTGSGKTICAEFAILRNHQRAVSGESNMRVVYIAP
IEALAKERYGDWERKFGEFAKVVELTGETAADLKLLDKGEIIVSTPEKWD
ALSRRWKQRKHIQQVSLFIVDELHLLGSDKGHVLEVIVSRMRRISSHIGS
NIRIVALSASLANAKDLGEWIGATSHGLFNFPPAVRPVPLEIYIQGVDIA
NFEARMQAMTKPTYTAITQHAKNSKPALVYVPTRKHARLTALDLCAYSSV
EGGGTPFLLGSEDEMDTFTRGVEEETLKNTLKCGVGYLHEGLSELDQELV
TQLFLGGRIQVCVASSTMCWGRPLPAHLVVVMGTQYYDGRENAHTDYPMR
DLLQMMGHASRPLQDNSGKCVILCHAPRKEYYKKFLFEAFPVESNLHHFL
HDHMNAEVVVGVVENKQDAVDYLTWTFMYRRLTKNPNFYNLQDVSHRHLS
DHLSELVETVLNDLESSKCVAIEEDMYLKPLNLGLIASYYYIGYTTIERF
SSMLTQKTKMKGLLEILASASEYAELPGRPGEEEFIERLVRHQRFSIEKP
KYGDPHVKANALLQAHFSRHTVVGNLAADQREILLSAHRLLQAMVDVISS
NGWLSLALSAMELSQMVTQGMWDRDSVLLQVPHFTKDLARRCQENEAKPI
ESIFDLAEMGVDEMRDLLQLSNSQLQDIIEFFKRFPNVDMTYEVREGDDI
STGDNVTVQVTLERDMTNLPSEVGPVHAPRFPKPKEEGWWLVIGDSSTNQ
LLSIKRVALQKRARVKLEFSAPAEAGRKDYMIYLMSDSYLGCDQEYEFTV
DVKDAGGD*
back to top