Sh_002I17_p000020

Overview
NameSh_002I17_p000020
Unique NameSh_002I17_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length723
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I17contigSh_002I17:9505..13859
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I17_t000020Sh_002I17_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I17_p000020 ID=Sh_002I17_p000020|Name=Sh_002I17_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=723bp
MNVPTYTSFAILPAARNLLTRHVNFLIANLPYNTKFWIDLSLLTFICKER
IRTAKTTRNKVGIDCTRGVSREQRAINRRNKLESSLVSSRTYVPSGNKRA
WNRNIKWMLERRAANEAYYNFEENLSAIAVQRFGEPFPDREDPNVAFEER
SFGEIVKPGQLTYPISTSYAVDLSSLVVSIALFDGDKMLFACSGIPIPHG
RTRQSLTRFVTSAHLVTQFNKNRNKDDKLRVAVRLPNNTGTDGFLGLYDK
DIAIVTCLGFLGVRPIDLDHKAKPFPGDSLKAAGRAFNSGSLMAMRGSLY
QKRPLKHLERLNTWVSDSQDISKAVLGGPLLGWDNKIVGMSLDIYDPGDA
NLRYTFLPMDLLCKRLKHFQILNPEKLHFRGYTLPKDVSSVVPSGFMQTI
CRLKSCDYPIPPPLVLEFNGQLLNHFEECFGELLPWKGYPFGHTPGGSGE
RVWNQLPKDVVTDVSRRVVSLASFNGYVRSFACTGLLIKWHGSKAKHTVI
LTSASLVRGRCNEDSIDNSLTIEVFLPPNQRAGGTLEFYNLDYNIAIVSL
KKNFSAICPDDIFAKSAQNTSKKVVAVGRDAKFGILMAASGEVKRGNKGC
KLDCKDVQLSTCKIKKAGIGGPLINLDGSFVGMNFYDGSGVTPFLPRHKI
VEVLSGADSLPSECGYNHPVPVNVIGGTKKQIQKNRPLVLSLYCLSYFDC
CNLQVGSRGDYVTSTVPLVLIS*
back to top