Sh_002I17_p000030

Overview
NameSh_002I17_p000030
Unique NameSh_002I17_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length78
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I17contigSh_002I17:21569..21802
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I17_t000030Sh_002I17_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I17_p000030 ID=Sh_002I17_p000030|Name=Sh_002I17_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=78bp
MIRHGDYHCPPCFSTGLVRRIISPTRRKKDLRPLELCDSDSDSNDESTAS
STSSGDTASPMACSMHTSVSAPSLTTL*
back to top