Sh_002I17_p000050

Overview
NameSh_002I17_p000050
Unique NameSh_002I17_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length253
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I17contigSh_002I17:33688..34446
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I17_t000050Sh_002I17_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I17_p000050 ID=Sh_002I17_p000050|Name=Sh_002I17_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=253bp
MHIHELMATKKSIFVIMEFGDDDSLNAHLVHRIDRGIGEASARCVRIPAA
RVHARLCHSLGVYHCDIKPDNILVDATGHIKVSDFGLLALASTAQREALL
HTICRTPMFIAPEVFLRCGYDGARADVWSYGVALFALVAGRFLFNHKDTS
FYHMIRRCDYYYPPFSILALSPIGLVRHILGPNRACCIAIPQVKKNLWFK
KDFKEIPESLSEPELRDSNSVSNDELMASSTSLGIRPPRWCAPCIPRCLR
CC*
back to top