Sh_002I17_t000050

Overview
NameSh_002I17_t000050
Unique NameSh_002I17_t000050
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length759
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteNon-specific serine/threonine protein kinase
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I17contigSh_002I17:33688..34446
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002I17_g000050Sh_002I17_g000050R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002I17_p000050Sh_002I17_p000050R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002I17_t000050 ID=Sh_002I17_t000050|Name=Sh_002I17_t000050|organism=R570 Sugarcane cultivar|type=mRNA|length=759bp
ATGCACATCCATGAGCTCATGGCGACCAAGAAGAGCATCTTCGTCATCAT
GGAGTTCGGCGATGACGACTCCCTCAATGCCCACCTCGTCCACCGCATCG
ACCGTGGCATCGGCGAGGCCTCAGCCCGCTGTGTACGTATTCCAGCAGCT
CGTGTCCACGCTCGACTATGCCACTCGCTTGGTGTGTACCACTGCGACAT
CAAGCCCGACAACATCCTCGTCGACGCCACTGGCCACATCAAGGTCTCTG
ATTTCGGGCTCTTGGCCCTCGCCAGCACGGCACAGCGGGAGGCGCTACTC
CACACCATCTGCAGGACACCCATGTTCATCGCGCCTGAGGTGTTCCTGCG
CTGCGGCTACGATGGCGCCAGGGCCGATGTCTGGTCCTACGGTGTTGCCC
TCTTCGCGCTCGTGGCAGGCCGCTTCCTCTTCAATCACAAGGACACAAGC
TTCTACCACATGATCCGCCGTTGTGACTACTACTACCCGCCGTTTTCTAT
ACTGGCCTTGTCGCCCATCGGCCTCGTCCGCCACATCCTCGGCCCTAACC
GGGCGTGCTGTATCGCCATACCGCAGGTCAAGAAAAATCTTTGGTTCAAG
AAGGACTTCAAGGAGATCCCAGAGAGCCTCAGTGAGCCCGAGTTGCGTGA
CTCTAACTCCGTTTCTAACGACGAGTTGATGGCGTCATCTACATCATTGG
GGATACGACCTCCCCGATGGTGTGCCCCATGCATACCTCGGTGTCTGCGC
TGTTGCTGA
back to top

protein sequence of Sh_002I17_p000050

>Sh_002I17_p000050 ID=Sh_002I17_p000050|Name=Sh_002I17_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=253bp
MHIHELMATKKSIFVIMEFGDDDSLNAHLVHRIDRGIGEASARCVRIPAA
RVHARLCHSLGVYHCDIKPDNILVDATGHIKVSDFGLLALASTAQREALL
HTICRTPMFIAPEVFLRCGYDGARADVWSYGVALFALVAGRFLFNHKDTS
FYHMIRRCDYYYPPFSILALSPIGLVRHILGPNRACCIAIPQVKKNLWFK
KDFKEIPESLSEPELRDSNSVSNDELMASSTSLGIRPPRWCAPCIPRCLR
CC*
back to top

mRNA from alignment at Sh_002I17:33688..34446+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002I17_t000050 ID=Sh_002I17_t000050|Name=Sh_002I17_t000050|organism=R570 Sugarcane cultivar|type=mRNA|length=759bp|location=Sequence derived from alignment at Sh_002I17:33688..34446+ (R570 Sugarcane cultivar)
ATGCACATCCATGAGCTCATGGCGACCAAGAAGAGCATCTTCGTCATCAT GGAGTTCGGCGATGACGACTCCCTCAATGCCCACCTCGTCCACCGCATCG ACCGTGGCATCGGCGAGGCCTCAGCCCGCTGTGTACGTATTCCAGCAGCT CGTGTCCACGCTCGACTATGCCACTCGCTTGGTGTGTACCACTGCGACAT CAAGCCCGACAACATCCTCGTCGACGCCACTGGCCACATCAAGGTCTCTG ATTTCGGGCTCTTGGCCCTCGCCAGCACGGCACAGCGGGAGGCGCTACTC CACACCATCTGCAGGACACCCATGTTCATCGCGCCTGAGGTGTTCCTGCG CTGCGGCTACGATGGCGCCAGGGCCGATGTCTGGTCCTACGGTGTTGCCC TCTTCGCGCTCGTGGCAGGCCGCTTCCTCTTCAATCACAAGGACACAAGC TTCTACCACATGATCCGCCGTTGTGACTACTACTACCCGCCGTTTTCTAT ACTGGCCTTGTCGCCCATCGGCCTCGTCCGCCACATCCTCGGCCCTAACC GGGCGTGCTGTATCGCCATACCGCAGGTCAAGAAAAATCTTTGGTTCAAG AAGGACTTCAAGGAGATCCCAGAGAGCCTCAGTGAGCCCGAGTTGCGTGA CTCTAACTCCGTTTCTAACGACGAGTTGATGGCGTCATCTACATCATTGG GGATACGACCTCCCCGATGGTGTGCCCCATGCATACCTCGGTGTCTGCGC TGTTGCTGA
back to top

Coding sequence (CDS) from alignment at Sh_002I17:33688..34446+

>Sh_002I17_t000050 ID=Sh_002I17_t000050|Name=Sh_002I17_t000050|organism=R570 Sugarcane cultivar|type=CDS|length=759bp|location=Sequence derived from alignment at Sh_002I17:33688..34446+ (R570 Sugarcane cultivar)
ATGCACATCCATGAGCTCATGGCGACCAAGAAGAGCATCTTCGTCATCAT
GGAGTTCGGCGATGACGACTCCCTCAATGCCCACCTCGTCCACCGCATCG
ACCGTGGCATCGGCGAGGCCTCAGCCCGCTGTGTACGTATTCCAGCAGCT
CGTGTCCACGCTCGACTATGCCACTCGCTTGGTGTGTACCACTGCGACAT
CAAGCCCGACAACATCCTCGTCGACGCCACTGGCCACATCAAGGTCTCTG
ATTTCGGGCTCTTGGCCCTCGCCAGCACGGCACAGCGGGAGGCGCTACTC
CACACCATCTGCAGGACACCCATGTTCATCGCGCCTGAGGTGTTCCTGCG
CTGCGGCTACGATGGCGCCAGGGCCGATGTCTGGTCCTACGGTGTTGCCC
TCTTCGCGCTCGTGGCAGGCCGCTTCCTCTTCAATCACAAGGACACAAGC
TTCTACCACATGATCCGCCGTTGTGACTACTACTACCCGCCGTTTTCTAT
ACTGGCCTTGTCGCCCATCGGCCTCGTCCGCCACATCCTCGGCCCTAACC
GGGCGTGCTGTATCGCCATACCGCAGGTCAAGAAAAATCTTTGGTTCAAG
AAGGACTTCAAGGAGATCCCAGAGAGCCTCAGTGAGCCCGAGTTGCGTGA
CTCTAACTCCGTTTCTAACGACGAGTTGATGGCGTCATCTACATCATTGG
GGATACGACCTCCCCGATGGTGTGCCCCATGCATACCTCGGTGTCTGCGC
TGTTGCTGA
back to top