Sh_002I17_t000090

Overview
NameSh_002I17_t000090
Unique NameSh_002I17_t000090
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1500
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteConserved hypothetical protein
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I17contigSh_002I17:54468..57737
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002I17_g000090Sh_002I17_g000090R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002I17_p000090Sh_002I17_p000090R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002I17_t000090 ID=Sh_002I17_t000090|Name=Sh_002I17_t000090|organism=R570 Sugarcane cultivar|type=mRNA|length=1500bp
ATGCAACGATTCAATGAACCTTTTCATGATAGAGAAGGTTCAAACGTTGC
TTTTGAGGAGAGGTCATTTGGTGATATAGTCAAACCTGGTGAAATAACTT
ATCCAATCAGTAGTAATTATGCTGTGGATCTGTCTTCCTTGGTCGTCTCA
CTCGCTTTGTTTGATGGAGATAAGATGCTATTCGCATGCTCAGGCATACC
TATACCTCACGGAAGAACTAGACAAAGCCTAACAAGATTTGTGACATCAG
CACATTTGGTTAGACAATTCAACGAGAAGAGAAATAAAGATGATAAGTTG
AGGGTTGGTGCTACTAATCATTGTGTTGTAGTGCGCCTTCCTAATAATAC
AGCTACTGATGGGTTCTTAGGACTATATGATAAAGACATTGCTATCGTCA
CATGCTTGGGCTTCCTAGGAGTCCGTCCTATAGATCTGGATCATAAGGCA
AAACTTTTCCCAGGTGATAGTTTGAAAGCGGCTGGGCGTGCCTTCAACTC
TGGCAGTTTGATGGCCATGCATGGATATCTGTATCAGAAACGCCCCCTCG
AACACCTCGAACACCTCAACACTTGGGTTTCTGATAGTCAAGATATCTCT
AAGTCAATGGGCGGTTGCTTAATCATTTTGAAGAATGCTTTTGGTGAATT
ACTTCCTTGGAAAGGGTTTCCCTATGGTGATCCACCCGGTGGCTCTGGGC
AACATGTCTGGAATCAACTTCCGAAAGAAGTTGTGACAGATGTATCCCGT
CGTGTCGTCTCACTTGCTTCATTCGATGGGTACGTGAGATCTTTTGCATG
CACAGGCTTGCTTAGAAAGTGGCATGGAAGCAAAGCTAAGCACACTGTCA
TCCTGACTTCAGCCAGTTTGGTTAGAGGTCATTGTAAAGAGGATAGCATT
GATAATAGCTTGACGATTGAGGTGTTTCTCCCACCGAATCAACGTGCTGG
TGGGACATTGGAATTTTATAATTTAGACTATAACATTGCTATTGTCAGTC
TCAAGAAGAATTTCAGTGCTATTTGTCCGGACGACATCTTCGTTGAAAGT
GCACAAAACTCATCTAAAAAGATTGTAACTATAGGGCGTGATGCTAAATT
TGGTATATTAATGGCCGCAAGTGGTGAAGTGATGCCAGGAAACAAGAGTT
GCGAACTTGATTGCAAAGATGTTCCGCTGTCTTCTTGTAAAATCAAGAAG
GCTGGGATTGGAGGCCCGCTTATTAATCTTGATGGGAGTTTTGTTGGCAT
GAACTTCTACGATGGAAGCGGTGTAACTCCTTTCTTACCAAGGCACAAGA
TTGTTAAAGTTCTAAGTGGAGTGAATTCTTTACCATCAGAATGTGGATAT
AACCATCCTATGCCTGTCAATGTTATTGGTGGGACAAAGAAGGGGATTCA
GAAATGCAGGTGGCCAGTGCCCGAGCCATATTGGTATCATGGCGCACTTG
ATGCAAGTGTTCATGATCTAGGCAAGCGTATTGGGCGGCGTCTTAATTAG
back to top

protein sequence of Sh_002I17_p000090

>Sh_002I17_p000090 ID=Sh_002I17_p000090|Name=Sh_002I17_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=500bp
MQRFNEPFHDREGSNVAFEERSFGDIVKPGEITYPISSNYAVDLSSLVVS
LALFDGDKMLFACSGIPIPHGRTRQSLTRFVTSAHLVRQFNEKRNKDDKL
RVGATNHCVVVRLPNNTATDGFLGLYDKDIAIVTCLGFLGVRPIDLDHKA
KLFPGDSLKAAGRAFNSGSLMAMHGYLYQKRPLEHLEHLNTWVSDSQDIS
KSMGGCLIILKNAFGELLPWKGFPYGDPPGGSGQHVWNQLPKEVVTDVSR
RVVSLASFDGYVRSFACTGLLRKWHGSKAKHTVILTSASLVRGHCKEDSI
DNSLTIEVFLPPNQRAGGTLEFYNLDYNIAIVSLKKNFSAICPDDIFVES
AQNSSKKIVTIGRDAKFGILMAASGEVMPGNKSCELDCKDVPLSSCKIKK
AGIGGPLINLDGSFVGMNFYDGSGVTPFLPRHKIVKVLSGVNSLPSECGY
NHPMPVNVIGGTKKGIQKCRWPVPEPYWYHGALDASVHDLGKRIGRRLN*
back to top

mRNA from alignment at Sh_002I17:54468..57737-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002I17_t000090 ID=Sh_002I17_t000090|Name=Sh_002I17_t000090|organism=R570 Sugarcane cultivar|type=mRNA|length=3270bp|location=Sequence derived from alignment at Sh_002I17:54468..57737- (R570 Sugarcane cultivar)
ATGCAACGATTCAATGAACCTTTTCATGATAGAGAAGGTTCAAACGTTGC TTTTGAGGAGAGGTCATTTGGTGATATAGTCAAACCTGGTGAAATAACTT ATCCAATCAGTAGTAATTATGCTGTGGATCTGTCTTCCTTGGTCGTCTCA CTCGCTTTGTTTGATGGTGATTGTGCTACTATACTTTTCAATTTTCCTAA ATTGCATTTAGTCATCACTTGTCATTTAAATCATGATATTTTCCAGGAGA TAAGATGCTATTCGCATGCTCAGGCATACCTATACCTCACGGAAGAACTA GACAAAGCCTAACAAGATTTGTGACATCAGCACATTTGGTTAGACAATTC AACGAGAAGAGAAATAAAGATGATAAGTTGAGGGTTGGTGCTACTAATCA TTGTGTTCCTTGATTTTTCTTTGTATATTCAAGCTAACTGTGAACATCCT GAGCTTGTGCTTGTGTATTGCTTTTATTTCTGTAGGTTGTAGTGCGCCTT CCTAATAATACAGCTACTGATGGGTTCTTAGGACTATATGATAAAGACAT TGCTATCGTCACATGCTTGGGCTTCCTAGGAGTCCGTCCTATAGATCTGG ATCATAAGGCAAAACTTTTCCCAGGTGATAGTTTGAAAGCGGCTGGGCGT GCCTTCAACTCTGGCAGTTTGATGGCCATGCATGGATATCTGTATCAGAA ACGCCCCCTCGAACACCTCGAACACCTCAACACTTGGGTTTCTGATAGTC AAGATATCTCTAAGGTATACTGTCAATTTATTTATTTGTGACTTTGTGGC ATGATGGAAAACATGGAACACATAATTGCGTTATGTCATTGCTGGTCTAA AGTATCACCGTGTGCATTGAAGCAAATCCTTTCTAAACCTACCACTTTGC TTTTGTTGTAGGCTGTACTTGGAGGGCCACTTCTGGGGTGCGATAAAACA ATTCTCGGCATAAACTTAGATATTTATGACCCTGATAATGGAATTTCGAG ATGCACCTTTCTATCTATGGACTTACTTCGCAAACGCTTGAAGCATTTTT AGATACTCAAGTATGTCTTCTACACTTACAGTATATATGAACTATTTCTT CAGTTAACCTGATTCATATTTGTTCCAAACCCTCTCTCCTAATCCACTTC CTGTTTAAGGTAAGCCATTTTTACTAACAGCATTGGAGACTTAGGAGTTT TCACATGGTAACCTATGGATTGAAAATAATCTGGTTCTTCTTACCCCTCT CTATTGAAACCAGTACCATTGCCAGATCTTACGATGCTAACTTAGTGCCC ATGCTTAATGCTTTGGTCTAAATTAGGAAGAATTAAACAATTCTTTGTGG CAATGTGTACAATGCAACTTGTATTTGTGACATGAATATGCTGAATCCTC TCATCTTTTGTTGAATATTTATGCCTGATTCCAAGTCATTATTTCATACC TTTATTTCTTTCACAAGACAAGATTAGATTCATGTGTTGTTATGATTTGG TTTTTTTCCCTATGTAGTTCCTGTATTTTATTGCCATAACAAGTCAACTA TGTTTTATTGCAGTCCTAAAAAACTAGACTTCCGTGGATATACATTGCCT AAACATGTATTCAGCATCGTTCCTTCAGGTGTGAACAATACTGCAAGCCA TCTTCTAAAATGTTGCCTATGTATCATTGTGCGCAGAATACTATGTTGCC AGTATCACACATATCATCTGAGGACTAACAGTGATCTCAATATTGCATCA GGGTTTATGCAAATTATTTGCAGGTTAAAGTCAAAAGGGTATCCCATTCC ACCACCACTTGTGCTCGAATGTAAGTGTTGCTTTTGATATTGCTGTCGTC TCCCTTGTCCCTTTTTGTAGTTCACTTCTGATCTTCTCTGTTTAAATAGT CAATGGGCGGTTGCTTAATCATTTTGAAGAATGCTTTTGGTGAATTACTT CCTTGGAAAGGGTTTCCCTATGGTGATCCACCCGGTGGCTCTGGGCAACA TGTCTGGAATCAACTTCCGAAAGAAGTTGTGACAGATGTATCCCGTCGTG TCGTCTCACTTGCTTCATTCGATGGTGATTTTTCCAGCTGTGTACTCCTT ACTTGTCTGTGCCACTAGTATTTTATCTTCACTAACTAATTAATGATTAA ACTTATAATGTGTAGGGTACGTGAGATCTTTTGCATGCACAGGCTTGCTT AGAAAGTGGCATGGAAGCAAAGCTAAGCACACTGTCATCCTGACTTCAGC CAGTTTGGTTAGAGGTCATTGTAAAGAGGATAGCATTGATAATAGCTTGA CGGTTGGTGCTCCTTAGTCCTTATCATTATTTTTGGTCTTTTAAGTTTAA TGATGGTTCACTATGCTCACTTTCTCATTGCAGATTGAGGTGTTTCTCCC ACCGAATCAACGTGCTGGTGGGACATTGGAATTTTATAATTTAGACTATA ACATTGCTATTGTCAGTCTCAAGAAGAATTTCAGTGCTATTTGTCCGGAC GACATCTTCGTTGAAAGTGCACAAAACTCATCTAAAAAGATTGTAACTAT AGGGCGTGATGCTAAATTTGGTATATTAATGGCCGCAAGTGGTGAAGTGA TGCCAGGAAACAAGAGTTGCGAACTTGATTGCAAAGATGTTCCGCTGTCT TCTTGTAAAATCAAGAAGGTACTGTGGTGAATCTCTCTTACTATTCTTTT ATATGGTAACCGGTTTAATCATATTGCATCTACTGAACTTATCAGGAATT TCAAGTTTTCCAGTAACCTTGGGCCTTTTTTTTAAACTAGGCTGGGATTG GAGGCCCGCTTATTAATCTTGATGGGAGTTTTGTTGGCATGAACTTCTAC GATGGAAGCGGTGTAACTCCTTTCTTACCAAGGCACAAGATTGTTAAAGT TCTAAGTGGAGTGAATTCTTTACCATCAGAATGGTATTATTTTCATCTGA ATGCTAACTTGTATAGGCATGACACATATTTTACAAACTTTGATTTTTTT TGTTTGATGACAGTGGATATAACCATCCTATGCCTGTCAATGTTATTGGT GGGACAAAGAAGGGGATTCAGAAATGCAGGTATTTCTTTCTGTTTTCGCA TTGCCACTTGTTTCTGTTTGCTTAGACTATTTTATTCACCAGCCAACTTA CCTTGGAACAAAAACATATTTGATGACAGGTGGCCAGTGCCCGAGCCATA TTGGTATCATGGCGCACTTGATGCAAGTGTTCATGATCTAGGCAAGCGTA TTGGGCGGCGTCTTAATTAG
back to top

Coding sequence (CDS) from alignment at Sh_002I17:54468..57737-

>Sh_002I17_t000090 ID=Sh_002I17_t000090|Name=Sh_002I17_t000090|organism=R570 Sugarcane cultivar|type=CDS|length=1500bp|location=Sequence derived from alignment at Sh_002I17:54468..57737- (R570 Sugarcane cultivar)
ATGCAACGATTCAATGAACCTTTTCATGATAGAGAAGGTTCAAACGTTGC
TTTTGAGGAGAGGTCATTTGGTGATATAGTCAAACCTGGTGAAATAACTT
ATCCAATCAGTAGTAATTATGCTGTGGATCTGTCTTCCTTGGTCGTCTCA
CTCGCTTTGTTTGATGGAGATAAGATGCTATTCGCATGCTCAGGCATACC
TATACCTCACGGAAGAACTAGACAAAGCCTAACAAGATTTGTGACATCAG
CACATTTGGTTAGACAATTCAACGAGAAGAGAAATAAAGATGATAAGTTG
AGGGTTGGTGCTACTAATCATTGTGTTGTAGTGCGCCTTCCTAATAATAC
AGCTACTGATGGGTTCTTAGGACTATATGATAAAGACATTGCTATCGTCA
CATGCTTGGGCTTCCTAGGAGTCCGTCCTATAGATCTGGATCATAAGGCA
AAACTTTTCCCAGGTGATAGTTTGAAAGCGGCTGGGCGTGCCTTCAACTC
TGGCAGTTTGATGGCCATGCATGGATATCTGTATCAGAAACGCCCCCTCG
AACACCTCGAACACCTCAACACTTGGGTTTCTGATAGTCAAGATATCTCT
AAGTCAATGGGCGGTTGCTTAATCATTTTGAAGAATGCTTTTGGTGAATT
ACTTCCTTGGAAAGGGTTTCCCTATGGTGATCCACCCGGTGGCTCTGGGC
AACATGTCTGGAATCAACTTCCGAAAGAAGTTGTGACAGATGTATCCCGT
CGTGTCGTCTCACTTGCTTCATTCGATGGGTACGTGAGATCTTTTGCATG
CACAGGCTTGCTTAGAAAGTGGCATGGAAGCAAAGCTAAGCACACTGTCA
TCCTGACTTCAGCCAGTTTGGTTAGAGGTCATTGTAAAGAGGATAGCATT
GATAATAGCTTGACGATTGAGGTGTTTCTCCCACCGAATCAACGTGCTGG
TGGGACATTGGAATTTTATAATTTAGACTATAACATTGCTATTGTCAGTC
TCAAGAAGAATTTCAGTGCTATTTGTCCGGACGACATCTTCGTTGAAAGT
GCACAAAACTCATCTAAAAAGATTGTAACTATAGGGCGTGATGCTAAATT
TGGTATATTAATGGCCGCAAGTGGTGAAGTGATGCCAGGAAACAAGAGTT
GCGAACTTGATTGCAAAGATGTTCCGCTGTCTTCTTGTAAAATCAAGAAG
GCTGGGATTGGAGGCCCGCTTATTAATCTTGATGGGAGTTTTGTTGGCAT
GAACTTCTACGATGGAAGCGGTGTAACTCCTTTCTTACCAAGGCACAAGA
TTGTTAAAGTTCTAAGTGGAGTGAATTCTTTACCATCAGAATGTGGATAT
AACCATCCTATGCCTGTCAATGTTATTGGTGGGACAAAGAAGGGGATTCA
GAAATGCAGGTGGCCAGTGCCCGAGCCATATTGGTATCATGGCGCACTTG
ATGCAAGTGTTCATGATCTAGGCAAGCGTATTGGGCGGCGTCTTAATTAG
back to top