Sh_002I19_p000020

Overview
NameSh_002I19_p000020
Unique NameSh_002I19_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length286
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC1.3.1.93
InterProIPR001104
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I19contigSh_002I19:20312..21169
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I19_t000020Sh_002I19_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I19_p000020 ID=Sh_002I19_p000020|Name=Sh_002I19_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=286bp
MWPSTTSWFPFLYPPPASAYVAAMSAVSLVSMANAGLAELRGDHMAYSKF
WHVVAAAGAGGNTKQRRGAGGGTGALLRSRDGMLLAYAPALLAAAASFAV
PGAVEGARAELLSAALAAHFLKRVLEVLFVHRYSGSMPLDTAATIACSYL
LSTATMIYAQHLSHDLPDPAVDLLYPGVLVFAVGLAGNFYHHYLLSNLRA
GDGGDDKGYKIPRGGLFGLVTCPHYLFEILAFFGFAMIAQTLYALAVATG
TAAYLAGRSCATRRWYRSKFQEFPSRIKALLPYVL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016627oxidoreductase activity, acting on the CH-CH group of donors
Vocabulary: Biological Process
TermDefinition
GO:0006629lipid metabolic process
Vocabulary: Cellular Component
TermDefinition
GO:0005737cytoplasm
GO:0016021integral component of membrane