Sh_002I19_p000030

Overview
NameSh_002I19_p000030
Unique NameSh_002I19_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length424
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.6.1.80
InterProIPR005958
InterProIPR015422
InterProIPR015424
InterProIPR004839
InterProIPR015421
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I19contigSh_002I19:24792..29846
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I19_t000030Sh_002I19_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I19_p000030 ID=Sh_002I19_p000030|Name=Sh_002I19_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=424bp
MATHAGENGSGGHEEWRFARAGKEAVAGDKMSIRAARFKISANVDARDPR
PVLPLAHGDPSVFPAFRTAAEAEDAVAAALRTGKFNCYPAGVGLPDARRA
LAEHLSSDLPYKLSTDDIFLTAGGTQAIEVVVSVLAQPGTNILLPRPGYP
NYEARAGLHNLEVRRFDLIPERGWEIDIDSLESIADKNTTAVVIINPNNP
CGSVAEVARKLGILVIADEVYGNLVFGGTPFVPMGVFGHTAPVLSIGSLS
KRWIVPGWRLGWVAVCDPNKILQKTKIIASITNFLNVSTDPATFIQGALP
HILENTKEDFFKRIIGLLAETSEICYREIKDIKCITCPHKPEGSMFVMVK
LNLYLLEGIYDDIDFCCKLAKEESVILCPGSVLGMENWIRITFAIDSSSL
LDGLERIKSFCQRHKKKNLLNGH*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008483transaminase activity
GO:0030170pyridoxal phosphate binding
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0006520cellular amino acid metabolic process
GO:0009058biosynthetic process