Sh_002I19_p000040

Overview
NameSh_002I19_p000040
Unique NameSh_002I19_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length280
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR012337
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I19contigSh_002I19:37400..38239
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I19_t000040Sh_002I19_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I19_p000040 ID=Sh_002I19_p000040|Name=Sh_002I19_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=280bp
MNISRRGVRLDTRCPVCFRFDEDGGHCFLKCKMIRRCWAALSLEPIRQML
LLKRSAWEVIVTVLGLKEDVCIKTMLLLWRWWSVRNKVNQGEKGLSADEV
AADVLKLISDMGSTERQQPIHREAAVKKWNAPPQGQLKINTDGSFIPEML
QGCWGFIVRDHEGGAVLAGAGRLGAAPDALSTEATACQQALQAATDYRIS
RIQVEVDSSVLQHALQSSTMDLATCEMMIKDTRFMLQEHFVCSGIISIPR
SCNSVAHDLAKLAMSWDPGNLYVWAHRLP*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding