Sh_002I19_p000050

Overview
NameSh_002I19_p000050
Unique NameSh_002I19_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length429
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.6.1.80
InterProIPR004839
InterProIPR015422
InterProIPR015421
InterProIPR005958
InterProIPR015424
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I19contigSh_002I19:59978..63847
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002I19_t000050Sh_002I19_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002I19_p000050 ID=Sh_002I19_p000050|Name=Sh_002I19_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=429bp
MATHGGENGSGHAAEWRFARVAKEGEGALAVAGDKLSIRAARFKIRASVD
ARDPRPVLPLAHGDPSVFPAFRTAAEAEDAVAAALRTGKFNCYPAGVGLP
DARRSLAEHLSSDLPYKLSTDDIFLTAGGTQAIEVVVSVLAQPGTNILLP
RPGYPNYEARAGLHNLEVRRFDLIPERGWEIDIDSLETIADKNTTAMVII
NPNNPCGSVAEVARKLGILVIADEVYGNLVFGDTPFVPMGVFGHVAPVLS
IGSLSKRWIVPGWRLGWVAVCDPNKILQKTKIIASITNFLNVSTDPATFI
QGALPHILENTTEDFFQRIIGLLAETSDICYREIKDIKCITCPHKPEGSM
FVMVKLNLYLLEGIHDDIDFCCKLAKEESVILCPGSVLGMENWIRITFAI
DSSSLLDGLERIKSFCQRHKKKNLLNGH*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0030170pyridoxal phosphate binding
GO:0003824catalytic activity
GO:0008483transaminase activity
Vocabulary: Biological Process
TermDefinition
GO:0009058biosynthetic process
GO:0006520cellular amino acid metabolic process