Sh_002I19_t000010

Overview
NameSh_002I19_t000010
Unique NameSh_002I19_t000010
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length558
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NotePutative protein
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I19contigSh_002I19:14483..15040
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002I19_g000010Sh_002I19_g000010R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002I19_p000010Sh_002I19_p000010R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002I19_t000010 ID=Sh_002I19_t000010|Name=Sh_002I19_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=558bp
ATGATGCAACACAACACCACCATGTCGGCGGCGGCGGCGAAGGCCAAGAG
AGGGGTCATCAGCAGCCTGCAGGGCCCGAGGCCGCTGCCGCTGAGCCTGC
CGGGCACCACCGCGTCGTCGTCGCCGCCCCCGCCGGCCAAGAGACCCCGC
GTCGCCAACAACGGCGGCAGCGACGACGACGATGTCAGGGCACCGCCGGC
GGCGCCGGGGCCAGTGATCGTGTACGAGCACACGCCCAAGGTCATCCACG
CGCGCCCCGACGAGTTCAAGGCCCTCGTGCAGAGGCTCACCGGCCGGCAA
CCAGCCGTGGGAGGCGGCGGCGATCAGGGTCAGGAGGCCGTGCTTCGGCC
CACACAGACGGCGGTGCTGCCGTCGTCGCAGCACCGGGACCCCCTGGTGC
TCACGCTCGGGCAGCAGCAGGTCCCGCCGCCGCCGCCGCTGCCGCTTGAT
GATCATCATCACACGCCGCCGGGCGGTGCTGCTGGTTTCCTTCTCTCCCC
GAGCAGCTTCCTCTTCTCGCCCGCCACCATGCAGGCCATACACGAGCTCA
TCAGCTGA
back to top

protein sequence of Sh_002I19_p000010

>Sh_002I19_p000010 ID=Sh_002I19_p000010|Name=Sh_002I19_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=186bp
MMQHNTTMSAAAAKAKRGVISSLQGPRPLPLSLPGTTASSSPPPPAKRPR
VANNGGSDDDDVRAPPAAPGPVIVYEHTPKVIHARPDEFKALVQRLTGRQ
PAVGGGGDQGQEAVLRPTQTAVLPSSQHRDPLVLTLGQQQVPPPPPLPLD
DHHHTPPGGAAGFLLSPSSFLFSPATMQAIHELIS*
back to top

mRNA from alignment at Sh_002I19:14483..15040+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002I19_t000010 ID=Sh_002I19_t000010|Name=Sh_002I19_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=558bp|location=Sequence derived from alignment at Sh_002I19:14483..15040+ (R570 Sugarcane cultivar)
ATGATGCAACACAACACCACCATGTCGGCGGCGGCGGCGAAGGCCAAGAG AGGGGTCATCAGCAGCCTGCAGGGCCCGAGGCCGCTGCCGCTGAGCCTGC CGGGCACCACCGCGTCGTCGTCGCCGCCCCCGCCGGCCAAGAGACCCCGC GTCGCCAACAACGGCGGCAGCGACGACGACGATGTCAGGGCACCGCCGGC GGCGCCGGGGCCAGTGATCGTGTACGAGCACACGCCCAAGGTCATCCACG CGCGCCCCGACGAGTTCAAGGCCCTCGTGCAGAGGCTCACCGGCCGGCAA CCAGCCGTGGGAGGCGGCGGCGATCAGGGTCAGGAGGCCGTGCTTCGGCC CACACAGACGGCGGTGCTGCCGTCGTCGCAGCACCGGGACCCCCTGGTGC TCACGCTCGGGCAGCAGCAGGTCCCGCCGCCGCCGCCGCTGCCGCTTGAT GATCATCATCACACGCCGCCGGGCGGTGCTGCTGGTTTCCTTCTCTCCCC GAGCAGCTTCCTCTTCTCGCCCGCCACCATGCAGGCCATACACGAGCTCA TCAGCTGA
back to top

Coding sequence (CDS) from alignment at Sh_002I19:14483..15040+

>Sh_002I19_t000010 ID=Sh_002I19_t000010|Name=Sh_002I19_t000010|organism=R570 Sugarcane cultivar|type=CDS|length=558bp|location=Sequence derived from alignment at Sh_002I19:14483..15040+ (R570 Sugarcane cultivar)
ATGATGCAACACAACACCACCATGTCGGCGGCGGCGGCGAAGGCCAAGAG
AGGGGTCATCAGCAGCCTGCAGGGCCCGAGGCCGCTGCCGCTGAGCCTGC
CGGGCACCACCGCGTCGTCGTCGCCGCCCCCGCCGGCCAAGAGACCCCGC
GTCGCCAACAACGGCGGCAGCGACGACGACGATGTCAGGGCACCGCCGGC
GGCGCCGGGGCCAGTGATCGTGTACGAGCACACGCCCAAGGTCATCCACG
CGCGCCCCGACGAGTTCAAGGCCCTCGTGCAGAGGCTCACCGGCCGGCAA
CCAGCCGTGGGAGGCGGCGGCGATCAGGGTCAGGAGGCCGTGCTTCGGCC
CACACAGACGGCGGTGCTGCCGTCGTCGCAGCACCGGGACCCCCTGGTGC
TCACGCTCGGGCAGCAGCAGGTCCCGCCGCCGCCGCCGCTGCCGCTTGAT
GATCATCATCACACGCCGCCGGGCGGTGCTGCTGGTTTCCTTCTCTCCCC
GAGCAGCTTCCTCTTCTCGCCCGCCACCATGCAGGCCATACACGAGCTCA
TCAGCTGA
back to top