Sh_002I19_t000030

Overview
NameSh_002I19_t000030
Unique NameSh_002I19_t000030
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1272
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteNicotianamine aminotransferase1
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002I19contigSh_002I19:24787..29854
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002I19_g000030Sh_002I19_g000030R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002I19_p000030Sh_002I19_p000030R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002I19_t000030 ID=Sh_002I19_t000030|Name=Sh_002I19_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=1272bp
ATGGCGACCCACGCCGGCGAGAACGGCAGCGGCGGGCACGAGGAGTGGCG
GTTCGCGCGGGCGGGCAAGGAGGCCGTGGCCGGGGACAAGATGAGCATCC
GGGCGGCGCGGTTCAAGATCAGCGCGAACGTGGACGCGCGCGACCCGCGG
CCCGTGCTGCCGCTGGCGCACGGGGACCCCTCGGTGTTCCCGGCCTTCCG
CACCGCCGCCGAGGCCGAGGACGCCGTGGCCGCCGCGCTCCGGACGGGCA
AGTTCAACTGCTACCCCGCCGGCGTCGGCCTCCCCGACGCCCGCCGTGCT
CTGGCGGAGCACCTGTCAAGTGATCTTCCATACAAGCTCTCAACTGATGA
CATCTTCCTCACTGCTGGAGGCACTCAAGCCATTGAGGTTGTCGTCTCAG
TCCTTGCCCAACCAGGCACCAACATATTGCTCCCAAGACCAGGCTATCCA
AACTATGAGGCGCGTGCAGGACTGCACAACTTAGAAGTTCGTCGTTTCGA
TCTGATTCCTGAAAGAGGGTGGGAAATTGATATTGACTCTCTGGAGTCGA
TTGCTGACAAGAACACCACCGCAGTGGTCATCATAAACCCCAACAATCCT
TGCGGGAGTGTCGCGGAGGTAGCAAGGAAGCTTGGAATACTAGTCATCGC
TGATGAAGTGTATGGAAATCTTGTGTTTGGGGGCACCCCTTTCGTCCCAA
TGGGTGTCTTTGGCCACACTGCCCCTGTGTTGAGCATAGGATCACTATCA
AAGAGATGGATAGTGCCTGGGTGGCGACTTGGTTGGGTAGCTGTATGTGA
TCCCAACAAGATTCTGCAAAAAACAAAGATCATTGCATCGATCACAAACT
TCCTTAACGTTTCAACTGATCCAGCAACTTTCATTCAGGGAGCACTTCCC
CATATTCTTGAGAACACAAAGGAAGATTTTTTCAAGAGGATCATTGGTCT
GCTAGCGGAAACATCAGAGATATGTTACAGAGAAATAAAGGACATCAAGT
GCATCACTTGCCCTCACAAGCCAGAAGGTTCCATGTTTGTCATGGTGAAA
TTAAATTTGTATCTTTTGGAAGGGATCTATGATGATATTGATTTTTGCTG
CAAGCTGGCAAAAGAAGAGTCCGTGATTTTGTGTCCAGGGAGTGTTTTGG
GAATGGAAAACTGGATCCGTATCACTTTCGCCATTGATTCATCTTCTCTT
CTTGATGGCCTTGAGAGGATCAAATCTTTCTGCCAAAGGCATAAGAAGAA
GAATTTGCTTAATGGCCATTAA
back to top

protein sequence of Sh_002I19_p000030

>Sh_002I19_p000030 ID=Sh_002I19_p000030|Name=Sh_002I19_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=424bp
MATHAGENGSGGHEEWRFARAGKEAVAGDKMSIRAARFKISANVDARDPR
PVLPLAHGDPSVFPAFRTAAEAEDAVAAALRTGKFNCYPAGVGLPDARRA
LAEHLSSDLPYKLSTDDIFLTAGGTQAIEVVVSVLAQPGTNILLPRPGYP
NYEARAGLHNLEVRRFDLIPERGWEIDIDSLESIADKNTTAVVIINPNNP
CGSVAEVARKLGILVIADEVYGNLVFGGTPFVPMGVFGHTAPVLSIGSLS
KRWIVPGWRLGWVAVCDPNKILQKTKIIASITNFLNVSTDPATFIQGALP
HILENTKEDFFKRIIGLLAETSEICYREIKDIKCITCPHKPEGSMFVMVK
LNLYLLEGIYDDIDFCCKLAKEESVILCPGSVLGMENWIRITFAIDSSSL
LDGLERIKSFCQRHKKKNLLNGH*
back to top

mRNA from alignment at Sh_002I19:24787..29854+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002I19_t000030 ID=Sh_002I19_t000030|Name=Sh_002I19_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=5068bp|location=Sequence derived from alignment at Sh_002I19:24787..29854+ (R570 Sugarcane cultivar)
TCCCCATGGCGACCCACGCCGGCGAGAACGGCAGCGGCGGGCACGAGGAG TGGCGGTTCGCGCGGGCGGGCAAGGAGGCCGTGGCCGGGGACAAGATGAG CATCCGGGCGGCGCGGTTCAAGATCAGCGCGAACGTGGACGCGCGCGACC CGCGGCCCGTGCTGCCGCTGGCGCACGGGGACCCCTCGGTGTTCCCGGCC TTCCGCACCGCCGCCGAGGCCGAGGACGCCGTGGCCGCCGCGCTCCGGAC GGGCAAGTTCAACTGCTACCCCGCCGGCGTCGGCCTCCCCGACGCCCGCC GGTACGTACGGTTACGGTGACTCAATTTCAATTCCTCTTGTCTTGTCTTG TCTTGGGCAAACTCATTTTCTAAGCTCGAGTTCAGAACAATCTTTGTCTT TACCTTACCGGCCTCATTTTCTAAGCTCGAGTCCCGATAGCCATGTGACC GGCATAAGCATTCTTTTGTTCATAGATACTTTCAGAAATTTTTAGAGTTA GTATCCTGTTAAGAGTAGTTAATTAGTAGGTGATTCAAATTGCACAGCAT CAATCACGACGCACTCAATAGCAAGGAGAATGGGGAAAACAAAAGATTTC TGCTCGGGTATGACACGTGCCGGCGCCGGTGCTCCACGAGGCCGCCTCGC CCGGCCTTGCGCTCGCCTCCGCCCCACCGCGTGATCTGCCTAGGCGGAGT AGGCATGGCCAAGCAATTTACTTTACCCAGTCACGCGCCATGCATGCGTC CGACGTGGCACGCCACCTGCTTTGTGGCGTTTTGTTTTTGGCAAAACCAT CTCTCAACCAAGGAAAAAGAGGCTTTCTGAAGTGGTTCTCATGATAGAGA CGTGTCTTACTTCCTTCATTCTTAGACTGTCCGCAGTGGCATACTCTAAA CGATACTCTAAAGTTTTAGAGTATGAATATAGAATAAAAACTGCTGCACT GGGTACTCTAAAATGATACTCTATCCTTTCTCTTACTCTATATTTAGAGT AGTACAGTGTTTACTCTATAGTGGGCAGTGACGGACCCCACTAGCTAAAC AAAGGAAAAAAATGCTAACTCACAAACCAAAAATCCAAATTAAATTTCGA TTGCACCATTAAATTCGTCTCAATAAATCCTTCAAAACTAGATCACACAT GGATATATTTATATAAAGTGACAAGTGGGTCCTATAGTGGATAGAGGATG ATATAGAGGATGGATGGGTGCGGGAGAATTGAGTATAGAGGAGAGAATCT TGCTGACTAGGACGTATAGATGATGAATACAGAGGTCCATGAGTGCGGAT AGTAATACCATACCACCATGGAGTATTTCCTAAGAAGAAAACGCTACCGG AAATGAAGGAAACTACCTACCTTGCTGGAATGAACTTGCTTGTTTTGATG AAGCACTTACAGGAGTCATGCATGGCAGGCCAAACACCGCCAAATATACA TAAACATGCAAAACCATCTCTCAACCAAGGAAAAGCCATGGCAGAAACAC TGTTTGTTGGCTGAAAAAGTACGGCTTATAAGCCAAGCGAACAGGAACTT CTCTAAAAATATTGCAGTATATTATCTTTCTTAATGACCTTCTATTAATA ATTCCACTTTTTCGTATATTCTTGCATGCTTATTATTGACCGGCTGGTGT AACCTGTTTACATTTAAAATTTTAAATACGTCCTTATATGAATACTGAAT TCTTTTTTGCTGCTTTAAATAATATAATAGTGCTCTGGCGGAGCACCTGT CAAGTGATCTTCCATACAAGCTCTCAACTGATGACATCTTCCTCACTGCT GGAGGCACTCAAGCCATTGAGGTTGTCGTCTCAGTCCTTGCCCAACCAGG CACCAACATATTGCTCCCAAGACCAGGCTATCCAAACTATGAGGCGCGTG CAGGACTGCACAACTTAGAAGTTCGTCGTTTCGATCTGATTCCTGAAAGA GGGTGGGAAATTGATATTGACTCTCTGGAGTCGATTGCTGACAAGAACAC CACCGCAGTGGTCATCATAAACCCCAACAATCCTTGCGGGAGTGTCTATA CCCATGAACATTTAGCCAAGGCATGACTGCTGCTTATTTCACTGATCATT CAAATGAAATTGAACTAGTTTTTTAACTAATCTTTGTGGAGACCAATGCA AATTGTGTTCTAAGCATGTCTTGATGTCATTTAGGTCGCGGAGGTAGCAA GGAAGCTTGGAATACTAGTCATCGCTGATGAAGTGTATGGAAATCTTGTG TTTGGGGGCACCCCTTTCGTCCCAATGGGTGTCTTTGGCCACACTGCCCC TGTGTTGAGCATAGGATCACTATCAAAGAGATGGATAGTGCCTGGGTGGC GACTTGGTTGGGTAGCTGTATGTGATCCCAACAAGATTCTGCAAAAAACA AAGGTAAATCATTAGCCCATATCTTACGTCCTTATTTTAGGTAGTGTTGC TATGCTGTTTCACCAACTACCGATTTTTGCAGATCATTGCATCGATCACA AACTTCCTTAACGTTTCAACTGATCCAGCAACTTTCATTCAGGTTAGTGG CTTGTACATTTTCCCCTACACTGTGGTATCCATTCATTTCAATTTTTTTC TCGACGTAGGAGAGCTGCATATCTTTTATATAATGAATACAGACCTCCAT TTCAAATAATTGAAAATGATTATACACAAACATGCGAGAGATTCTTTTAA TAATAATACCTTGTGAAATAATTATCTCATCAATTCAAATGTGTTGAAAA TAATGGTGATTTTGAGTTGCGCTATTTCATTTTGCCCTGCGATCTGTGGC AGGAAAAATGCAATGCTATTTTAGATAACTTACCAAGGTTTGTCATTACG AGATCAGAAAAATGGGAAATTGTCTCTATCTGTATACATGCTTTCAGGAT CCCAGTTCCTAACTAGTATTCATTTTTATTTTCGCAAGCATGTGTCTTAC CTGTTATATCTCAGATAACTAAGAGTTATTGTAAAAAAATTGATTAGGGA GCACTTCCCCATATTCTTGAGAACACAAAGGAAGATTTTTTCAAGAGGAT CATTGGTCTGCTAGCGGAAACATCAGAGATATGTTACAGAGAAATAAAGG ACATCAAGTGCATCACTTGCCCTCACAAGCCAGAAGGTTCCATGTTTGTC ATGGTAAGCAATTTACTAAATTATATGTTGTTAAAGTGGTTGAACAGAAA AAAATAGTAATACAAAAGAAACAGTGAAGGATTGTGTTAGAGCAACCAGC ACCTAAAGTGCTAATATACCTAAAGTTTCAATTTACTCCACTAGCTCTTG TCTATTTAGAATTTATTTATTTTTTCATCAAAATTAGTCATGTTATTATA TAAACATTATATCTCTATATATGTATCTGTTACACACAACCACAGCGAAT GAAACATATAGATAATCTTAGAACTTGTTTGTCAATTTTCTAACTTGGAG AAGTCACAAACAGGTGAAATTAAATTTGTATCTTTTGGAAGGGATCTATG ATGATATTGATTTTTGCTGCAAGCTGGCAAAAGAAGAGTCCGTGATTTTG TGTCCAGGTGAGATGAATTTGATTTTTTCTGGAAAAAAATATATCTGACA AAATCTCATTTTTGGCTCTAGCAATTGTATGTTTCAGGTTACAAGTATTC CAGGCTTAACTGTACGTTTGTGCTCAGAAAATGCTTTAAGAAATTAGCAA TGCATTAATGCTGGAATACAATCATGAATCATCTTTTTTTCATATATTGA ACAAAATGTAACATCGGTGATTCACTAATATATAAATGTTGGGATGATTC TCCTTTATCTTCTTATAGATGTTAGTGAAGAATAGACAGAGAGATATACT CCTTGGTAACTTGTGAGATTTTGGGAGTAGCTTTGACTAGACTTAAGTGT CTATTTGTTTAGGCTAGACAGGTAGATATTTGTTACGTTCGCAAAAAAAA AGGAAAAATCTTCTCTATATAATGAGAGGAGATGTATCAATCTAATCAAG CAACAGATTAGAATGAAAAACCTTCTCTCTTGCCGGCCGTGGGCGAAGCC CCGCGGCTGGCGTTCCCAGCGCCCTCACAGCCCTAGCTGCCAGTCCTCGG CCTCTCAAGCTGTGAACAGTACCCGTGGGTACTGTAGCACGGCAGTCGCT GTTGCTCCTTCCCCTCTCCTCTCGACCCCAACAGCCCACATAACAGATTC ACTAATATATAAATGTTGGGATGATTCTCCTTTATCTTCTTATAGGTGTT AGTGAAGAGTAGACAGAGAGATATACTCCTTGGTAACTTGTGAGATTTTG GGAGTAGCTTTGACTAGACTTAAGTGTCTATTTGTTTAGGCTAGACAGGT AGATATTTGTTACGTTCGCAAAAAAAAGGAAAAATCTTCTCTATATAATA AGAGGAGATGTATCAATCTAATCAAGCAACAGATTAGAAGAAAAAACCTT CTCTCTTGTCGGCCGTGGGCGAAGCCCCGCGGTTGGCGTTCCCAGTGCCC CTCAGCCCTAGCCGCCGGTCCTCTGCCTCTCAAGCCATGAACAGTACCCG CGGTACTGTAGCGCGGCAGCCGCCGTTGCTCTCTCCCCTCTCCTCTCGAT CCCAACAGCCCACATAACAGATTCAACAACAACATAGCCTTTTGTCCCAA GCAAATATAAATGTTGGGATGATTCTCCTTTATCTTCTTATAGGTGTCAG TGAAGAGTAGACAGAGAGATATACTCCTTGGTAACTTGTGAGATTTGGGA GTAGCTTTGACTAGACTTAAGTGTCTAATTGTTTAGGCTAGAGAGGTAGA TATTTGTTACATTTGCAAAAAAAAGTAGGTATTTGTTACTCTAAGGTACT GGTTAATATAAGTGTCTCATCTTAAATTAATACCAACATCTACTTAATCT TACATACACGTGTTTCTCCAATGCAGGGAGTGTTTTGGGAATGGAAAACT GGATCCGTATCACTTTCGCCATTGATTCATCTTCTCTTCTTGATGGCCTT GAGAGGATCAAATCTTTCTGCCAAAGGCATAAGAAGAAGAATTTGCTTAA TGGCCATTAACTGTATCT
back to top

Coding sequence (CDS) from alignment at Sh_002I19:24787..29854+

>Sh_002I19_t000030 ID=Sh_002I19_t000030|Name=Sh_002I19_t000030|organism=R570 Sugarcane cultivar|type=CDS|length=1272bp|location=Sequence derived from alignment at Sh_002I19:24787..29854+ (R570 Sugarcane cultivar)
ATGGCGACCCACGCCGGCGAGAACGGCAGCGGCGGGCACGAGGAGTGGCG
GTTCGCGCGGGCGGGCAAGGAGGCCGTGGCCGGGGACAAGATGAGCATCC
GGGCGGCGCGGTTCAAGATCAGCGCGAACGTGGACGCGCGCGACCCGCGG
CCCGTGCTGCCGCTGGCGCACGGGGACCCCTCGGTGTTCCCGGCCTTCCG
CACCGCCGCCGAGGCCGAGGACGCCGTGGCCGCCGCGCTCCGGACGGGCA
AGTTCAACTGCTACCCCGCCGGCGTCGGCCTCCCCGACGCCCGCCGTGCT
CTGGCGGAGCACCTGTCAAGTGATCTTCCATACAAGCTCTCAACTGATGA
CATCTTCCTCACTGCTGGAGGCACTCAAGCCATTGAGGTTGTCGTCTCAG
TCCTTGCCCAACCAGGCACCAACATATTGCTCCCAAGACCAGGCTATCCA
AACTATGAGGCGCGTGCAGGACTGCACAACTTAGAAGTTCGTCGTTTCGA
TCTGATTCCTGAAAGAGGGTGGGAAATTGATATTGACTCTCTGGAGTCGA
TTGCTGACAAGAACACCACCGCAGTGGTCATCATAAACCCCAACAATCCT
TGCGGGAGTGTCGCGGAGGTAGCAAGGAAGCTTGGAATACTAGTCATCGC
TGATGAAGTGTATGGAAATCTTGTGTTTGGGGGCACCCCTTTCGTCCCAA
TGGGTGTCTTTGGCCACACTGCCCCTGTGTTGAGCATAGGATCACTATCA
AAGAGATGGATAGTGCCTGGGTGGCGACTTGGTTGGGTAGCTGTATGTGA
TCCCAACAAGATTCTGCAAAAAACAAAGATCATTGCATCGATCACAAACT
TCCTTAACGTTTCAACTGATCCAGCAACTTTCATTCAGGGAGCACTTCCC
CATATTCTTGAGAACACAAAGGAAGATTTTTTCAAGAGGATCATTGGTCT
GCTAGCGGAAACATCAGAGATATGTTACAGAGAAATAAAGGACATCAAGT
GCATCACTTGCCCTCACAAGCCAGAAGGTTCCATGTTTGTCATGGTGAAA
TTAAATTTGTATCTTTTGGAAGGGATCTATGATGATATTGATTTTTGCTG
CAAGCTGGCAAAAGAAGAGTCCGTGATTTTGTGTCCAGGGAGTGTTTTGG
GAATGGAAAACTGGATCCGTATCACTTTCGCCATTGATTCATCTTCTCTT
CTTGATGGCCTTGAGAGGATCAAATCTTTCTGCCAAAGGCATAAGAAGAA
GAATTTGCTTAATGGCCATTAA
back to top