Sh_002L05_p000010

Overview
NameSh_002L05_p000010
Unique NameSh_002L05_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length369
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR019020
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002L05contigSh_002L05:12808..15888
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002L05_t000010Sh_002L05_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002L05_p000010 ID=Sh_002L05_p000010|Name=Sh_002L05_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=369bp
MMRLLAILFAAAALAVATTAHEHHGEAPTCAGGSGHVLAEFRPGEVTVDA
HSDDWDSVEASEFALLPALDPDEDKAYSGGKVAVKAVHDGVNVFFLLQVD
GAYAYTKGESNKCPSVALMFQVGEKATFYNMGGCKDMPDSCTSKSCRGHE
VDIMHFSIGNAIPGRLYGGNHIDNAAGNGNDRFGHLVDVYAWNPHCRYLD
GVGPKENNSNAQNDWHGAWWHSSLTVHSGFVDDDNPYGKQDEKGTYYFEF
SRPLRTMDQFQQDAQFTIGHPSNMAVAFWYPTDGKAWSNSDHYSASCNWL
VLDIQPSSEAAYYRPAPNRSWDAATAFALLLSVVAICMSIFVGYRFSRNR
STAQFTPLEQIQFAEERH*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0020037heme binding