Sh_002L05_p000020

Overview
NameSh_002L05_p000020
Unique NameSh_002L05_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length335
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR007854
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002L05contigSh_002L05:16728..18693
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002L05_t000020Sh_002L05_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002L05_p000020 ID=Sh_002L05_p000020|Name=Sh_002L05_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=335bp
MADSLDAAAAFAVSTNDNNVDDVEDLYADLDEQVAAALAAAGESGGSNAR
DSDPVTDGEGEVPEPDANEAVDLGDGTEGYSSSDEESDDGLRIVLNEDTS
APLPPLPVGRGEGCVDEDEEGGDTGNRVKGSSVNDGGWATVGGLHCKGLI
EKTPLPSMGQIDRGRQHVFQRDYNFTLPRNGTIFDIGIEAFQQKPWRQQG
VDLTDYFNFSLDEEGWRKYWCSMKQLRLGARSLVNETSGLEQESYKLKSV
KAMSKVANDSGSEGRNGLGKPKGRAIHVEGSACERVPSADLWRPIQRDSD
VVIQVNMTLSPSNQSTSDDSSKLNHNGVATERYA*
back to top