Sh_002L05_p000030

Overview
NameSh_002L05_p000030
Unique NameSh_002L05_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length619
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR013026
InterProIPR019734
InterProIPR011990
InterProIPR003107
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002L05contigSh_002L05:32863..38407
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002L05_t000030Sh_002L05_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002L05_p000030 ID=Sh_002L05_p000030|Name=Sh_002L05_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=619bp
MAMRLLSPSTPPPLFPSPGPKAPASISASSSSNFSVRLRRARAASAAAGA
AAAGGSDRDGGRFEGEAMSGAFDRGLAEIARKVPLFEPAADGELAAAAGE
RPLPINLELWLYRVKVHTRKFEFPEAEKLLDKCISFWPEDGRPYVALGKL
YSKQSRYDKARAVYERGCQATQGENPYIWQCWAVLESKSGNIRRARELFD
ASTVADAKHIAAWHGWAILEIKQGNIKKARNLLGKALKYCGGNEYIYQTL
ALLEAKAERFEQARTLFEQATQSNSKSCASWLAWAQVEMRAGNNTMARKL
FEKAVQASPKNRFSWHVWALFEANEGSIDRARKLLKIGHAVNPRDPVILQ
SLALLEYNFSSANVARVLFRKASQIDPRHQPVWIAWGWMEWKEGNARTAR
ALYQRALSVNSTNECAARCLQAWGVLEQRAGNYTAARRLLRSSLSINSQS
EVTWMTWAALEEEQGDPVRAEEIRNLYFQQRTEVVDDASWVMGFLDIIDP
ALDSVKKLLNLDQPSGPTRQDDVKSTARSFEAGESSETSAAVGSDSSGLK
SHDAGNNGSEATGTPTSDFDLDGFIKKRLALDPAELDAVLEGSDPRGVVS
QRRKQRLPRKPLPLLPAP*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
Vocabulary: Biological Process
TermDefinition
GO:0006396RNA processing