Sh_002L05_p000040

Overview
NameSh_002L05_p000040
Unique NameSh_002L05_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length340
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002L05contigSh_002L05:41489..42890
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_002L05_t000040Sh_002L05_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_002L05_p000040 ID=Sh_002L05_p000040|Name=Sh_002L05_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=340bp
MLPARALTLETYHRFFLDPWNTRITVDQLNQVLGRCGQAKIMERLVGQVD
LLPPRRSTLHRAALSVATPPSAAVITAAQARDDVEAIGWAECPIGCVAAF
AAPSADAPEPVERVPWPADFVLTGRRPRSKRTRGSAYGPRDVAAASMKSK
AGAGAPRKQVKVVVKEEEREPELVPPPPPPPLWTRSPTPPPPASPPPPQD
VVPPPPPPPPPCQPQPTLAPIPLPPGWGTPMGLPHPSQQLFLGSPLPTRP
TAQPCPATPPPGWSVPTPPPSFPAPFWGAPVMLPPLPPHVAWRWPPGTAP
HWGSMLSPEHPPMHLQRSPPPLLLQHSHHRIFRVSRCLR*
back to top