Sh_002L05_t000010

Overview
NameSh_002L05_t000010
Unique NameSh_002L05_t000010
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1107
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
Notesimilar to Expressed protein
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002L05contigSh_002L05:12578..16211
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002L05_g000010Sh_002L05_g000010R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002L05_p000010Sh_002L05_p000010R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002L05_t000010 ID=Sh_002L05_t000010|Name=Sh_002L05_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=1107bp
ATGATGAGGCTACTCGCCATCCTGTTCGCCGCGGCGGCCCTCGCGGTCGC
CACCACCGCGCACGAGCACCATGGCGAGGCGCCCACCTGCGCCGGAGGCA
GCGGGCACGTGCTCGCGGAGTTCCGCCCCGGGGAGGTGACCGTGGACGCG
CACAGCGACGACTGGGACAGCGTCGAGGCCTCGGAGTTCGCGCTGCTGCC
GGCGCTCGATCCAGACGAAGATAAGGCCTACTCCGGCGGCAAGGTCGCCG
TAAAGGCTGTGCATGATGGTGTCAACGTCTTCTTCTTGCTTCAGGTTGAT
GGGGCTTACGCTTACACTAAAGGGGAAAGTAACAAATGCCCTTCTGTTGC
TCTGATGTTCCAAGTTGGAGAGAAAGCCACATTTTACAATATGGGAGGAT
GCAAAGATATGCCAGATTCATGCACAAGTAAAAGTTGTAGAGGTCATGAG
GTTGACATCATGCACTTCTCAATTGGAAATGCTATTCCTGGACGACTTTA
CGGTGGCAATCACATAGATAATGCAGCTGGGAATGGAAACGACAGATTTG
GTCACCTTGTTGATGTCTATGCATGGAATCCACATTGCCGATACCTTGAT
GGAGTGGGCCCTAAAGAGAACAATTCAAATGCTCAAAATGATTGGCATGG
GGCTTGGTGGCACAGTTCACTTACCGTCCATTCAGGCTTCGTTGATGATG
ATAATCCTTATGGAAAACAAGATGAGAAGGGCACATATTATTTTGAGTTT
TCAAGACCCTTAAGAACAATGGATCAATTTCAGCAGGATGCACAGTTCAC
TATAGGACATCCCAGCAATATGGCCGTAGCCTTTTGGTACCCAACTGATG
GCAAAGCATGGAGCAACTCCGATCATTACTCAGCCAGCTGTAACTGGTTG
GTTTTGGATATACAACCTTCATCCGAAGCAGCTTATTACCGTCCAGCTCC
TAATCGCTCTTGGGATGCTGCAACTGCCTTTGCTTTACTTCTTTCAGTGG
TAGCCATTTGCATGTCCATCTTTGTGGGCTACCGATTTTCTAGGAACAGG
AGCACTGCCCAGTTTACACCACTTGAACAGATCCAGTTTGCTGAAGAACG
CCATTGA
back to top

protein sequence of Sh_002L05_p000010

>Sh_002L05_p000010 ID=Sh_002L05_p000010|Name=Sh_002L05_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=369bp
MMRLLAILFAAAALAVATTAHEHHGEAPTCAGGSGHVLAEFRPGEVTVDA
HSDDWDSVEASEFALLPALDPDEDKAYSGGKVAVKAVHDGVNVFFLLQVD
GAYAYTKGESNKCPSVALMFQVGEKATFYNMGGCKDMPDSCTSKSCRGHE
VDIMHFSIGNAIPGRLYGGNHIDNAAGNGNDRFGHLVDVYAWNPHCRYLD
GVGPKENNSNAQNDWHGAWWHSSLTVHSGFVDDDNPYGKQDEKGTYYFEF
SRPLRTMDQFQQDAQFTIGHPSNMAVAFWYPTDGKAWSNSDHYSASCNWL
VLDIQPSSEAAYYRPAPNRSWDAATAFALLLSVVAICMSIFVGYRFSRNR
STAQFTPLEQIQFAEERH*
back to top

mRNA from alignment at Sh_002L05:12578..16211+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002L05_t000010 ID=Sh_002L05_t000010|Name=Sh_002L05_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=3634bp|location=Sequence derived from alignment at Sh_002L05:12578..16211+ (R570 Sugarcane cultivar)
TCACAGGGGTACTCCCGTCAACTCCTCCTGTTCACGGGCTGAAGCGAAAA TTCAGCCCCAATCGGGCCGGCGACGGACGCCTCCTTGTTCTCCACGCCGC CGCCGCTGCGTGGGCTAGGCTGACTTGACCAATCTCGACCTATCGAGGCT CTTGCTGCCCCCGACCACGGAAGGAGCCTCCTGCAGTGTGGCTCCGGTCG ACCACGAAGCCTCGATCTGCTCGTCCCTGCATGATGAGGCTACTCGCCAT CCTGTTCGCCGCGGCGGCCCTCGCGGTCGCCACCACCGCGCACGAGCACC ATGGCGAGGCGCCCACCTGCGCCGGAGGCAGCGGGCACGTGCTCGCGGAG TTCCGCCCCGGGGAGGTGACCGTGGACGCGCACAGCGACGACTGGGACAG CGTCGAGGCCTCGGAGTTCGCGCTGCTGCCGGCGCTCGATCCAGACGAAG ATAAGGCCTACTCCGGCGGCAAGGTCGCCGTAAAGGTTCGCCTCTTCCAG GCTCTCTTCTTCGTCGTCTTCTCTTTCTCTTCCTCTCCCCCACAGCGAAA CATGTGGATCACGAAAAGTTAGGCTGATCGCAATTAGATTCAGAACTGAC TGTGTTGTCGAAATGGGGCCCGATAAGCCGAATCATGGACTTTTAGCATT TTGCTGTTTGGAGAAGCAAAATATTAGATTTATCTGGGATAGCTAAGCTA GATGATCGAGTTCAGTTTTCTACTAATACTTTGAAACCTTGATGTCTCCG AAGTGGTGCTTTATTAACTTCGGAAGTTGGCTGTGCAGGCTGTGCATGAT GGTGTCAACGTCTTCTTCTTGCTTCAGGTTGATGGGGCTTACGCTTACAC TAAAGGGTACTTTCGCTTTCTTTCTGTGTTACTACATCTGTACCAGTGCG GATAGAGCGATAGTGGAGGTTGTAGTGCTCTTTATGGCCACTCTTTTAGT TCAGAGACGTTGGACAACCAATCAGCTACTCCTATATTGTTTTGATGCAC AAATCCATCACGATCTGTTTGTCCTTTAACTTTGACATTGTCAGTTGATG GGAGGCCTATAGATTTATACATGGTTCTCGATTGTTCTGTTAAATAGTAC TAGTATCATAACAGCTTTTCTTATCGTGTTGGTCTTCTTTAAGGCCTGAT GGTGTTTTAACTGGATTGAATATACCCTGGCATGACAACCCCCCACCCAT TGTCTTGGGTCTTCTTTAAGGCATGTTGCTGGTTTGATTTGATTGATTGT GCCTTATGAGAACGATTTCATTCTCAAAGTGGATTTTAGCCTTCCACTAT TAATTTAAACATATAGCTCTGTATCTAGTAACCTGTGCTTTTGGTTCACC TGTTCATAACACAGGGAAAGTAACAAATGCCCTTCTGTTGCTCTGATGTT CCAAGTTGGAGAGAAAGCCACATTTTACAATGTAAGTTTGGGTTGCTTCC AGCTATGAACCATTACAAGTGTAATTTCATGCATGCATTGAGCTTTTTTA TCATTATTATGTATAATAGCTCCTTTTTGTATTTCTGAACAATGCCTTTC GTACTCTTTCTTATTGGTTATTGTATAATGTATGCCCAACATTATTACTG TTTGGCCTTTTTAGATGGGAGGATGCAAAGATATGCCAGATTCATGCACA AGTAAAAGTTGTAGAGGTCATGAGGTTGACATCATGCACTTCTCAATTGG AAATGCTATTCCTGGACGACTTTACGGTGGCAATCACATAGATAATGCAG CTGGGAATGGAAACGACAGGTTACTATGTTCTACTTTGCTACATGATGGT CGTGTACTTATGTATTGTATGAATAGAAACTTATGGTTAGAGTATTTCTT TATTTAGATTTGGTCACCTTGTTGATGTCTATGCATGGAATCCACATTGC CGATACCTTGATGGAGTGGGCCCTAAAGGTAGACATGCTTATAAAATTCA GAAATCATCATGTATGGATTATATGTTTGGTTATTTTCCTACTAACCTTT TTTTTATTGAACTTTGTTTGGGACAAAACTTGTTTCAGAGAACAATTCAA ATGCTCAAAATGATTGGCATGGGGCTTGGTGGCACAGTTCACTTACCGTC CATTCAGGCATACCATCAGACTCATTTCTCTTTTATCTTTACTTCATACT TGGTTTGGTTATGAATTCTAAAGAACATAACATATGGAGATCATCTTCTG AGAGTTCACAACTTGAGTTTGCATGCTTTAATCTTCTAAATGCCCCTTTT CTCCAACTGCATATATATTTTTTAAAACAAGCAATGGACTTCCACTGCAA CAATATGGAAACATAAGCTCTCGACAATGTAACTTGGCTAGTCATCAGTA TACCTTAATTGAAAGTTGATCAAATGGCAAATACATGCAAGATAAATTTG TTATCTAATGGCTATTTGAAATCTTCTTCCAGGCTTCGTTGATGATGATA ATCCTTATGGAAAACAAGATGAGAAGGGCACATATTATTTTGAGTTTTCA AGACCCTTAAGAACAATGGATCAATTTCAGCAGGTACTTATCCACTAACA CATTACATTCAAGATACTGCAGTATGAGTGCCTGCACTATCATGTTTCAG TTAGTTAATGGCAACTTAAATCATTAATCTGTATATAAACTGCGTTAAGC AACATTAACACATTTTTCTTAGTAGACAACACATATTCTGGATGGATTCC TAGTTATCTGGTCTCTACTGCGATGCAACCATGCCATTATCAATCTGTGG AACTGTTAAGGTACACAACCAAAACAAAAACAGGCATCTTGTGCCCAGGG TGCTTTGACAAATCCACCTCATCTGTACTTATGATGGGCCGATGTGTATG TGTATCTATTTCAAAAAATGTGGACTGACTGACATGATACCTTCTGATAT ATCAATTCAACCTGCTTGAAGTTTTATGTTTTACTGTATTTACCCTAACC AAATATAGTAATAAAATAAAATGCTCCTTTGGCGATGCAGGATGCACAGT TCACTATAGGACATCCCAGCAATATGGCCGTAGCCTTTTGGTACCCAACT GATGGCAAAGCATGGAGCAACTCCGATCATTACTCAGCCAGCTGTAACTG GTTGGTTTTGGATATACAACCTTCATCCGAAGCAGCTTATTACCGTCCAG CTCCTAATCGCTCTTGGGATGCTGCAACTGCCTTTGCTTTACTTCTTTCA GTGGTAGCCATTTGCATGTCCATCTTTGTGGGCTACCGATTTTCTAGGAA CAGGAGCACTGCCCAGTTTACACCACTTGAACAGATCCAGTTTGCTGAAG AACGCCATTGATTGGAATTGAGATTAGGCGAAGCAGCAAGCAACACTGTT TCATCTGTTTCACCATTGTACCTCCAAAGTTGACAGATTGCTGCATTGCA GTTTTGAACCGGGTTGTTGTGATCTAGTATAGGACATATTGAAGCATGCA CAATACAGAATTACAGACTGCCGATTTTTATTGTAGGAAACAATTTCTGT AAATGCTGTACATCAACTCTGGGTTATTGGCTTACTGCGCCACTTGATAT CATTCTAGATTCTACCTGAGCACATGATTGTGGTGGTTGTTTCATTGGTT GTATAATATTTGAATATATCTAAGGGCCTAAATT
back to top

Coding sequence (CDS) from alignment at Sh_002L05:12578..16211+

>Sh_002L05_t000010 ID=Sh_002L05_t000010|Name=Sh_002L05_t000010|organism=R570 Sugarcane cultivar|type=CDS|length=1107bp|location=Sequence derived from alignment at Sh_002L05:12578..16211+ (R570 Sugarcane cultivar)
ATGATGAGGCTACTCGCCATCCTGTTCGCCGCGGCGGCCCTCGCGGTCGC
CACCACCGCGCACGAGCACCATGGCGAGGCGCCCACCTGCGCCGGAGGCA
GCGGGCACGTGCTCGCGGAGTTCCGCCCCGGGGAGGTGACCGTGGACGCG
CACAGCGACGACTGGGACAGCGTCGAGGCCTCGGAGTTCGCGCTGCTGCC
GGCGCTCGATCCAGACGAAGATAAGGCCTACTCCGGCGGCAAGGTCGCCG
TAAAGGCTGTGCATGATGGTGTCAACGTCTTCTTCTTGCTTCAGGTTGAT
GGGGCTTACGCTTACACTAAAGGGGAAAGTAACAAATGCCCTTCTGTTGC
TCTGATGTTCCAAGTTGGAGAGAAAGCCACATTTTACAATATGGGAGGAT
GCAAAGATATGCCAGATTCATGCACAAGTAAAAGTTGTAGAGGTCATGAG
GTTGACATCATGCACTTCTCAATTGGAAATGCTATTCCTGGACGACTTTA
CGGTGGCAATCACATAGATAATGCAGCTGGGAATGGAAACGACAGATTTG
GTCACCTTGTTGATGTCTATGCATGGAATCCACATTGCCGATACCTTGAT
GGAGTGGGCCCTAAAGAGAACAATTCAAATGCTCAAAATGATTGGCATGG
GGCTTGGTGGCACAGTTCACTTACCGTCCATTCAGGCTTCGTTGATGATG
ATAATCCTTATGGAAAACAAGATGAGAAGGGCACATATTATTTTGAGTTT
TCAAGACCCTTAAGAACAATGGATCAATTTCAGCAGGATGCACAGTTCAC
TATAGGACATCCCAGCAATATGGCCGTAGCCTTTTGGTACCCAACTGATG
GCAAAGCATGGAGCAACTCCGATCATTACTCAGCCAGCTGTAACTGGTTG
GTTTTGGATATACAACCTTCATCCGAAGCAGCTTATTACCGTCCAGCTCC
TAATCGCTCTTGGGATGCTGCAACTGCCTTTGCTTTACTTCTTTCAGTGG
TAGCCATTTGCATGTCCATCTTTGTGGGCTACCGATTTTCTAGGAACAGG
AGCACTGCCCAGTTTACACCACTTGAACAGATCCAGTTTGCTGAAGAACG
CCATTGA
back to top