Sh_002L05_t000030

Overview
NameSh_002L05_t000030
Unique NameSh_002L05_t000030
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1857
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteProtein high chlorophyll fluorescent 107
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_002L05contigSh_002L05:32658..38649
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_002L05_g000030Sh_002L05_g000030R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_002L05_p000030Sh_002L05_p000030R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_002L05_t000030 ID=Sh_002L05_t000030|Name=Sh_002L05_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=1857bp
ATGGCGATGCGGCTCCTGTCCCCCTCCACGCCGCCCCCACTCTTCCCGAG
CCCCGGCCCGAAGGCACCCGCCTCCATCTCCGCATCGTCTTCCTCCAACT
TCTCTGTCCGCTTGCGCCGCGCGCGCGCGGCTTCTGCAGCGGCTGGCGCG
GCCGCGGCGGGCGGGTCCGACCGGGACGGCGGACGCTTCGAGGGGGAGGC
GATGAGCGGGGCATTCGACAGGGGCCTCGCGGAGATCGCGAGGAAGGTAC
CGCTCTTCGAGCCCGCAGCGGACGGGGAGCTCGCCGCCGCGGCCGGCGAG
CGGCCGTTGCCTATCAATCTCGAGCTCTGGCTCTACCGCGTCAAAGTGCA
CACCAGGAAGTTCGAGTTCCCTGAAGCAGAGAAGCTTCTCGACAAGTGTA
TCTCATTCTGGCCTGAAGACGGACGTCCGTATGTGGCACTGGGGAAGCTG
TACAGCAAGCAGTCAAGGTATGACAAAGCTAGAGCGGTGTACGAAAGGGG
ATGCCAAGCAACGCAAGGCGAAAACCCATACATTTGGCAGTGCTGGGCAG
TCCTAGAAAGCAAGAGTGGAAATATTCGAAGGGCACGCGAGCTATTTGAT
GCTTCTACTGTGGCTGATGCAAAGCACATTGCTGCTTGGCACGGGTGGGC
AATTTTAGAAATAAAGCAAGGAAATATAAAAAAGGCGCGGAACCTACTTG
GGAAAGCCCTGAAATATTGTGGAGGAAATGAGTATATTTACCAAACTCTT
GCTTTGCTTGAAGCTAAAGCAGAGCGCTTTGAACAAGCACGGACTTTGTT
TGAGCAAGCCACTCAATCCAATTCTAAAAGTTGTGCAAGCTGGCTAGCTT
GGGCTCAGGTAGAAATGCGTGCAGGAAACAATACCATGGCCAGAAAGCTC
TTTGAGAAGGCTGTCCAGGCTAGTCCTAAAAACCGTTTCTCATGGCATGT
TTGGGCATTATTTGAGGCAAATGAAGGTAGCATTGACAGGGCAAGGAAGT
TGCTTAAGATTGGACATGCTGTAAATCCTAGGGACCCTGTAATTCTCCAG
TCACTTGCACTGCTGGAATACAACTTTTCATCTGCGAATGTTGCTCGTGT
GTTATTCAGAAAAGCATCTCAGATTGATCCAAGGCATCAGCCAGTTTGGA
TAGCTTGGGGGTGGATGGAATGGAAAGAAGGAAATGCAAGAACAGCAAGG
GCCCTCTATCAAAGAGCTTTGTCAGTTAATTCAACAAATGAATGTGCTGC
TCGTTGTCTTCAGGCTTGGGGAGTCCTAGAACAGCGTGCTGGTAACTACA
CGGCTGCCAGAAGATTGTTGAGGTCTTCTCTGAGTATAAACTCTCAAAGT
GAGGTGACATGGATGACATGGGCAGCACTTGAGGAGGAACAGGGGGATCC
AGTTCGAGCTGAAGAAATTCGGAACCTTTACTTTCAGCAGCGTACTGAAG
TTGTGGATGATGCCTCATGGGTCATGGGCTTCCTTGACATCATCGACCCT
GCCCTAGACAGCGTGAAGAAGCTGCTAAACCTAGATCAGCCTTCTGGGCC
GACGAGGCAAGATGATGTTAAAAGCACTGCCAGGAGTTTTGAAGCTGGGG
AGTCTTCAGAAACTTCTGCGGCTGTAGGTTCAGATTCCTCTGGCCTTAAG
AGCCATGATGCTGGTAACAACGGGAGCGAAGCAACGGGGACTCCAACAAG
TGATTTCGATTTGGATGGTTTCATCAAAAAGAGGCTGGCCCTCGACCCGG
CGGAGCTGGATGCCGTGCTCGAGGGCTCTGACCCGAGGGGTGTTGTTTCT
CAGAGGAGGAAACAGCGGCTGCCCAGGAAGCCACTCCCTCTTCTCCCTGC
CCCGTAA
back to top

protein sequence of Sh_002L05_p000030

>Sh_002L05_p000030 ID=Sh_002L05_p000030|Name=Sh_002L05_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=619bp
MAMRLLSPSTPPPLFPSPGPKAPASISASSSSNFSVRLRRARAASAAAGA
AAAGGSDRDGGRFEGEAMSGAFDRGLAEIARKVPLFEPAADGELAAAAGE
RPLPINLELWLYRVKVHTRKFEFPEAEKLLDKCISFWPEDGRPYVALGKL
YSKQSRYDKARAVYERGCQATQGENPYIWQCWAVLESKSGNIRRARELFD
ASTVADAKHIAAWHGWAILEIKQGNIKKARNLLGKALKYCGGNEYIYQTL
ALLEAKAERFEQARTLFEQATQSNSKSCASWLAWAQVEMRAGNNTMARKL
FEKAVQASPKNRFSWHVWALFEANEGSIDRARKLLKIGHAVNPRDPVILQ
SLALLEYNFSSANVARVLFRKASQIDPRHQPVWIAWGWMEWKEGNARTAR
ALYQRALSVNSTNECAARCLQAWGVLEQRAGNYTAARRLLRSSLSINSQS
EVTWMTWAALEEEQGDPVRAEEIRNLYFQQRTEVVDDASWVMGFLDIIDP
ALDSVKKLLNLDQPSGPTRQDDVKSTARSFEAGESSETSAAVGSDSSGLK
SHDAGNNGSEATGTPTSDFDLDGFIKKRLALDPAELDAVLEGSDPRGVVS
QRRKQRLPRKPLPLLPAP*
back to top

mRNA from alignment at Sh_002L05:32658..38649+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_002L05_t000030 ID=Sh_002L05_t000030|Name=Sh_002L05_t000030|organism=R570 Sugarcane cultivar|type=mRNA|length=5992bp|location=Sequence derived from alignment at Sh_002L05:32658..38649+ (R570 Sugarcane cultivar)
GACCTCCAACCGCGCCCCCATCCCGGCCTCCCGCTTCTGCCCCTCCAACC CCGGGTACGGCAGCAACGGCACCGCATCCACGAGGGCAGTCCCGTCAGTC CAGGCCCCTCGTCCTTCTCCTTCCCTCCCAAGGGCGCGCCTCGCTCCACC CTCCCCACTGGCGAATTTGCTACGGGCAAGCTCCGCTCGAGCTCGGCCCG CATCCATGGCGATGCGGCTCCTGTCCCCCTCCACGCCGCCCCCACTCTTC CCGAGCCCCGGCCCGAAGGCACCCGCCTCCATCTCCGCATCGTCTTCCTC CAACTTCTCTGTCCGCTTGCGCCGCGCGCGCGCGGCTTCTGCAGCGGCTG GCGCGGCCGCGGCGGGCGGGTCCGACCGGGACGGCGGACGCTTCGAGGGG GAGGCGATGAGCGGGGCATTCGACAGGGGCCTCGCGGAGATCGCGAGGAA GGTACCGCTCTTCGAGCCCGCAGCGGACGGGGAGCTCGCCGCCGCGGCCG GCGAGCGGCCGTTGCCTATCAATCTCGAGCTCTGGCTCTACCGCGTCAAA GTGCACACCAGGAAGTTCGAGTTCCCTGAAGCAGAGAAGCTTCTCGACAA GGTAGAGAATTATAGCATTACGCGTTAGGAGTTCATACACGAGCAGAATG TTTCTCTACCTAGCGCATCAAGGCAGCATGAAACTATTAAACGCGTGTTG TGTGCTCGAACTGAGTACTTTTGGGCAAGTTGTTGGGTTGCGAGCTCTGA TGGATTTTATGCTCTGTTTCTGAAATCTGAACAGTGTATCTCATTCTGGC CTGAAGACGGACGTCCGTATGTGGCACTGGGGAAGCTGTACAGCAAGCAG TCAAGGTATGACAAAGCTAGAGCGGTGTACGAAAGGGGATGCCAAGCAAC GCAAGGCGAAAACCCATACATTTGGCAGGTTTGCACATGATCAGTTCATA TGCTCCATTTTATAAAGTACCTATATGCAAGACGTTTTTTTCTCAAACAA GTACGAGAGGCAAAAGTCTATTGATGTTAGTCTACTCTACCTCCATTGGC CGGATTCGTGGCTCCGCATCAAGAGCATGCGTACGAGTATTCGTTGGAAC TCTGCCAGCCGGCCGAATAAAAATGATTAATCCAATTGAGCTGTGAAATC ATCGAAGCATCAACTGCAAGTTCATGGATATGATGTGCAGTAGGAGAGCT CGAAGTGGGATCTATGGCTGTCAATCGAAGTTGGGGAACCCAGAAGAAGA TGGGATGGAGAAAACCCACCATATGCCAAACGGTAGACTTTTCACAGCTT CTCATTTGACAAAAGCTAGCTTATCATAAAAGCTTCCTTATCAAATAAGC CCATCAAAGATAAGTAGTTTCAAACAGGGCCAATTGATGTTAGTCTACTT TACCCCCTAACCTACAAAGCCAGGTATTCTACCTCTTACCTATCCAAAAT CGTTTAATCTAACCCATAGGTGGTTTCAAGTGCTCATTTTGCCTCGCTGG CATGACTAGAGCCCGCAGTCAATGTTTCGAGTGGTCATTTTGCCTCGCTG GCATGACTAGAGCCCACATGACAGTGACCATTGTTGCATGGGCCCACTTG TTAGCGTCTCCTTCAACCTCCGGCCTTTGTGCACCCTGAGCTTATCCAAG GGCGTGTTGTCACCGCCGTTGCCTAGGGCTAATCATACTGTGCTTTACCA TCGTCACCTACTGCCTCTGAGCCAAACCGCGCCATGTCACTGCATCCACA CATGACCATTGCCACACAACGAGTACTGATGAGTCCACGAAGGACCAAGT GCCTCCGACCATTAGCAGCGTCGGTCATGTACATTACTGTCTTGGTCGTT TTACATGTATACCCTCGTGGAATAGTGTAATAATTAGGGGTTTCATGTCT CTCGGTGTTTTTACGAATAACCTCCTAAAACCCTTAGACTTTTTCCTACA GGAGCGTGGCGTATCATTATATTAAGAAGAAGAAATGCGGTCTAGAACCC CCACACAAAACACACACCCAAAAACAAGAAACAAGAAGGATAAACACATG CATCTAGTATTACAAAAGAAACAAGATCCGAACCACTAACTAAACTTCTT GGGGCAGAAGGGAGAGGAGATAAGAAACACCTTGCACCCTGGCTAGGCTC CAAAACCTCATCTCCTCCATAGCAAGCTATACAACACCATCTAGGTAGGG AGAAGCACCATCGAAGGCACAATGGTTGCAATGAGTCCCCCAGACCCCCA AAATGATGAGTGAATTTAAACTTTTACAAACCTGGCCATCGACTCTGTCA TCGATTTGAGTCCACATTCCTCAAAGGATGTAGACCATGAGAATGTTAAC ACCTTATGTCGGGTTTGGGAAACTCTGCAACTATTTGTTAAATTTGAAGG GGCGTGAGTTAGCATGATCCTAATTGTATGATGATGTTGTTTTGCATTTG ATTCAACAACTGGCAGTTTGGGCATTTGGTCGTCAGTTCAGTAATTGTAT TCCTTGCATGCCAGCTGCTTGTCTGCTTTTCTTCCAAATAGATGGAGAGC ATAGCCTGTTACGTGATACATCGCACACATTATTTTGTTTGTAGAAACAA CGGTTGGTCTCCCAGTTGTAGCTATCCTGTAAAGTTTTCAAGATTAAAAG GGATTGAAACCTCATATCAGGATCGTTTTGTTAACTTTTACTGACACATC CGAAAACATAATCACTTGGACCATCTAAAGAAATCATTTGATCCTTATGA CTGAATTATATACAACATGCTGAAATCACTATCCAGATTGGTGAGGTCAG GGCAATCTGTGCCTTTACAACCATAACTATTTATGTTCCATGCATGATGC ATCTATAATTCACTCATTTAAGGATAAATCCAACAAAGCATGTGACCGTA TATGAATTTGTTGTTTTCTTTGCTAAGCAGTGCTGGGCAGTCCTAGAAAG CAAGAGTGGAAATATTCGAAGGGCACGCGAGCTATTTGATGCTTCTACTG TGGCTGATGCAAAGCACATTGCTGCTTGGCACGGGTGGGCAATTTTAGAA ATAAAGCAAGGAAATATAAAAAAGGCGCGGAACCTACTTGGGAAAGCCCT GAAATATTGTGGAGGAAATGAGTATATTTACCAAACTCTTGCTTTGCTTG AAGCTAAAGCAGAGCGCTTTGAACAAGCACGGACTTTGTTTGAGCAAGCC ACTCAATCCAATTCTAAAAGTTGTGCAAGCTGGCTAGTAAGTATTTGCTT CATAATTATTCATTTTCTCTGCACGAAAGGAAACTGCATAGTTGCCTTAT CTATTAAACTGTGCATTTATATATGACAACTCTCTAGTAGGCTTGGGCTC AGGTAGAAATGCGTGCAGGAAACAATACCATGGCCAGAAAGCTCTTTGAG GTAATAAACCGTGTTCCCTTTCTAGGTTAACTATTGCTGTCATTAATGAT TTTGTAAATTCCAAAATATATCTGAGCGTCTCCTCATGTTCATGAGTCAG TTAAAGTGCAAAATAGAAATGGTATTACTATGGGCTCAGTCTTTCTTTGT CTAAATTTTTCATAGAAGATCTGTCTAGTCTCTACCAGTATGAATATAGA GCTTGATATTCATTTGTTCAAGTTATATTGCACTGTTGTTTTGACATTCT ATATTAACATGTGAATGTGATGGTTTGTCACATATATGACATCCCTCTAA AATTTTCCAATGTGTGGTGCGTAACTTCAAATTTTCTAGTGCAGAAGGCT GTCCAGGCTAGTCCTAAAAACCGTTTCTCATGGCATGTTTGGGCATTATT TGAGGCAAATGAAGGTAGCATTGACAGGGCAAGGAAGTTGCTTAAGATTG GACATGCTGTAAATCCTAGGGACCCTGTAATTCTCCAGTCACTTGCACTG CTGGAATACAACTTTTCATCTGCGAATGTTGCTCGTGTGTTATTCAGAAA AGCATCTCAGATTGATCCAAGGCATCAGCCAGTTTGGATAGTAAGAACTT TCTGCATTTACCTCCCTTATCTGACTACAAATTCCATGTAGTTTCCTTTA CAAAAAATTGTTTGAGATTTTTTTTTCTTTATTCCCTACAGGATGTTCTG CATGGATATACAACTACTTTCAGTATGATGTTGTTTCTTGCAGTTCTTAC CACTAGAGGATAGAGGTTTCTTTTTGGGAGAAACTTCTTAGCATTAGAAC TTACAAGTGTTGTGGTTGTTTACCTTCCCAGTGCAAATGAGTGCATATAT ACAATCCAATGATTCGGGGAGCGATTAGGTCCAGTGAATGGCGAATTCAA AATATTTTTGTTTTTTGTTGTTGAAACTTTGGATTTATATTCATGTAAGA TCCCCAGCAATAAACTGTGAAAGTAAATTTCTTTCAGTAGAAAGCCTTAG ATCGTCAACTAACTGCACCTGATATGCACGAGTAAAAACTTTAAGTTTTC TAAAAATGTTAGAAACAGTTTTCTATAATTTCAAGTACATACGCATTGTC ATATTTGTGTCTAATTGTATATGCACTGCTGCTGATTTATGTTAGTCTCT GAAACTCAGCAATGACCCATAGATTATATTGTAGGCTTGGGGGTGGATGG AATGGAAAGAAGGAAATGCAAGAACAGCAAGGGCCCTCTATCAAAGAGCT TTGTCAGTTAATTCAACAAATGAATGTGCTGCTCGTTGTCTTCAGGTAAA GCATATCATTCAGTTAGCCTGGGAGTTGTCAAACTGTCAGAAATGACTTA TCTTTAATGTCATTGTTTATTCACAAGACCATTTGAGTGCTTGATGAACT ACTGTATCATGGTTGTCAAATATGAATGCTTGCATTACTGAAGAATCTAG TTTGCCAGAACTGTATACAAGTAACCAGAATTAAATTTATTTTACTGTGA TCTAGTATATGGGTCTAAAATTACCAAGCTTCGGTGCTGATTTCAGTACT GTTTAGGCTAGTGTTCCATTTTCTATTCCATAAATAGTTGTCGGGTGCTT TTGTAGGCTTGGGGAGTCCTAGAACAGCGTGCTGGTAACTACACGGCTGC CAGAAGATTGTTGAGGTCTTCTCTGAGTATAAACTCTCAAAGTGAGGTGA CATGGATGACATGGGCAGCACTTGAGGAGGAACAGGGGGATCCAGTTCGA GCTGAAGAAATTCGGAACCTTTACTTTCAGCAGGTTAGTTCAGGTTGCCT GCAGAGCTACATCTTTATCTGTTCATGCGGTGTGTGTGTCTGTAGTTCAG AGCATGAACTATAATTGTTAGTGTTCAGCTTATCTTATTGCGATATCCTT GACAATGCCATGGACTGTTTTCCATGCTGGCAGCGTACTGAAGTTGTGGA TGATGCCTCATGGGTCATGGGCTTCCTTGACATCATCGACCCTGCCCTAG ACAGCGTGAAGAAGCTGCTAAACCTAGATCAGCCTTCTGGGCCGACGAGG CAAGATGATGTTAAAAGCACTGCCAGGAGTTTTGAAGCTGGGGAGTCTTC AGAAACTTCTGCGGCTGTAGGTTCAGATTCCTCTGGCCTTAAGAGCCATG ATGCTGGTAACAACGGGAGCGAAGCAACGGGGACTCCAACAAGTGATTTC GATTTGGATGGTTTCATCAAAAAGAGGCTGGCCCTCGACCCGGCGGAGCT GGATGCCGTGCTCGAGGGCTCTGACCCGAGGGGTGTTGTTTCTCAGAGGA GGAAACAGCGGCTGCCCAGGAAGCCACTCCCTCTTCTCCCTGCCCCGTAA ATTTTCCAGATCGGTCTGTCTCCACCGGTAATATCCACTGGCAGTAGCAG GTATCGTGAATTGCAATACGTGGATATGTGTGAGTAGAGGACGACCCCTG CCGCTGCCATAGCAATCACCTGTTAATTGTCATTCCAGCCACGTGTATGT AATTCTGCCACCATCTGTAGTAAGTCTAGCTCTGTACATAAATTAGACTC TCTTTATCTACATAATTTCCCCGAGTTATCGAGAAATATTCT
back to top

Coding sequence (CDS) from alignment at Sh_002L05:32658..38649+

>Sh_002L05_t000030 ID=Sh_002L05_t000030|Name=Sh_002L05_t000030|organism=R570 Sugarcane cultivar|type=CDS|length=1857bp|location=Sequence derived from alignment at Sh_002L05:32658..38649+ (R570 Sugarcane cultivar)
ATGGCGATGCGGCTCCTGTCCCCCTCCACGCCGCCCCCACTCTTCCCGAG
CCCCGGCCCGAAGGCACCCGCCTCCATCTCCGCATCGTCTTCCTCCAACT
TCTCTGTCCGCTTGCGCCGCGCGCGCGCGGCTTCTGCAGCGGCTGGCGCG
GCCGCGGCGGGCGGGTCCGACCGGGACGGCGGACGCTTCGAGGGGGAGGC
GATGAGCGGGGCATTCGACAGGGGCCTCGCGGAGATCGCGAGGAAGGTAC
CGCTCTTCGAGCCCGCAGCGGACGGGGAGCTCGCCGCCGCGGCCGGCGAG
CGGCCGTTGCCTATCAATCTCGAGCTCTGGCTCTACCGCGTCAAAGTGCA
CACCAGGAAGTTCGAGTTCCCTGAAGCAGAGAAGCTTCTCGACAAGTGTA
TCTCATTCTGGCCTGAAGACGGACGTCCGTATGTGGCACTGGGGAAGCTG
TACAGCAAGCAGTCAAGGTATGACAAAGCTAGAGCGGTGTACGAAAGGGG
ATGCCAAGCAACGCAAGGCGAAAACCCATACATTTGGCAGTGCTGGGCAG
TCCTAGAAAGCAAGAGTGGAAATATTCGAAGGGCACGCGAGCTATTTGAT
GCTTCTACTGTGGCTGATGCAAAGCACATTGCTGCTTGGCACGGGTGGGC
AATTTTAGAAATAAAGCAAGGAAATATAAAAAAGGCGCGGAACCTACTTG
GGAAAGCCCTGAAATATTGTGGAGGAAATGAGTATATTTACCAAACTCTT
GCTTTGCTTGAAGCTAAAGCAGAGCGCTTTGAACAAGCACGGACTTTGTT
TGAGCAAGCCACTCAATCCAATTCTAAAAGTTGTGCAAGCTGGCTAGCTT
GGGCTCAGGTAGAAATGCGTGCAGGAAACAATACCATGGCCAGAAAGCTC
TTTGAGAAGGCTGTCCAGGCTAGTCCTAAAAACCGTTTCTCATGGCATGT
TTGGGCATTATTTGAGGCAAATGAAGGTAGCATTGACAGGGCAAGGAAGT
TGCTTAAGATTGGACATGCTGTAAATCCTAGGGACCCTGTAATTCTCCAG
TCACTTGCACTGCTGGAATACAACTTTTCATCTGCGAATGTTGCTCGTGT
GTTATTCAGAAAAGCATCTCAGATTGATCCAAGGCATCAGCCAGTTTGGA
TAGCTTGGGGGTGGATGGAATGGAAAGAAGGAAATGCAAGAACAGCAAGG
GCCCTCTATCAAAGAGCTTTGTCAGTTAATTCAACAAATGAATGTGCTGC
TCGTTGTCTTCAGGCTTGGGGAGTCCTAGAACAGCGTGCTGGTAACTACA
CGGCTGCCAGAAGATTGTTGAGGTCTTCTCTGAGTATAAACTCTCAAAGT
GAGGTGACATGGATGACATGGGCAGCACTTGAGGAGGAACAGGGGGATCC
AGTTCGAGCTGAAGAAATTCGGAACCTTTACTTTCAGCAGCGTACTGAAG
TTGTGGATGATGCCTCATGGGTCATGGGCTTCCTTGACATCATCGACCCT
GCCCTAGACAGCGTGAAGAAGCTGCTAAACCTAGATCAGCCTTCTGGGCC
GACGAGGCAAGATGATGTTAAAAGCACTGCCAGGAGTTTTGAAGCTGGGG
AGTCTTCAGAAACTTCTGCGGCTGTAGGTTCAGATTCCTCTGGCCTTAAG
AGCCATGATGCTGGTAACAACGGGAGCGAAGCAACGGGGACTCCAACAAG
TGATTTCGATTTGGATGGTTTCATCAAAAAGAGGCTGGCCCTCGACCCGG
CGGAGCTGGATGCCGTGCTCGAGGGCTCTGACCCGAGGGGTGTTGTTTCT
CAGAGGAGGAAACAGCGGCTGCCCAGGAAGCCACTCCCTCTTCTCCCTGC
CCCGTAA
back to top