Sh_003K10_p000110

Overview
NameSh_003K10_p000110
Unique NameSh_003K10_p000110
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length164
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003K10contigSh_003K10:86583..87074
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003K10_t000110Sh_003K10_t000110R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003K10_p000110 ID=Sh_003K10_p000110|Name=Sh_003K10_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=164bp
MTSLVRSGGSVNGGLYRASTNGPLMAYPSFSSAALSPSAFSLTVLSVATP
LNLATPNFLSGTSRITTRSSVGRGASSTLVYLDGSRNCIFTLPGACWSSV
ITGAVIATGSGSPPVPVVMTGAVMAIFSAESPPSPSPPPVVMTGAVMAIF
SGLVFCGLPRAPM*
back to top