Sh_003K10_p000120

Overview
NameSh_003K10_p000120
Unique NameSh_003K10_p000120
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length337
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR011042
InterProIPR004141
InterProIPR018119
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003K10contigSh_003K10:88741..89815
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003K10_t000120Sh_003K10_t000120R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003K10_p000120 ID=Sh_003K10_p000120|Name=Sh_003K10_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=337bp
MGRRNNLATTSRPPTRAGASTFLYQAASGAPRGLAFDGKGEGPYAGVSDG
RILKWGGTTVGWTTFAHSANYRKIPLCTAGVVPSEETESMCGRPLGLQFH
GKTGDLYIAGAYLGLMRVGPGGGEAEVLATGADGVPFNFVNGLDVDQATG
DVYFTDSSTTYPRRFNTEIMMNADATGRLLRYDAQTKSVTVLKAGLPYPN
GVAVSRDGAQVVVAHTVPCQAFRYFLRGAREGQYDLLADLPGYPDNVRRD
NKGGYWVALNQQKQRLDATPTTAPVKHLVGVRLDADGVEVEELTAAKGVT
LSDVAEMKGQLWLGSVELEYGRVQFGRIGRGRFCTV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016844strictosidine synthase activity
Vocabulary: Biological Process
TermDefinition
GO:0009058biosynthetic process