Sh_003K10_p000130

Overview
NameSh_003K10_p000130
Unique NameSh_003K10_p000130
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length387
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR011611
InterProIPR029056
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003K10contigSh_003K10:98730..100737
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003K10_t000130Sh_003K10_t000130R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003K10_p000130 ID=Sh_003K10_p000130|Name=Sh_003K10_p000130|organism=R570 Sugarcane cultivar|type=polypeptide|length=387bp
MAAPALLLPSLFPKPTLLVASLHSSLPRGLPLRCSPNGAAVPESPEPASR
RGRKKSPSPSAPKAKATRRRTKKADQDPDSEGAEEPAKRTSRRTRKSKEE
AKQEEVAQAAGQGTEETIPEANEEECAVEAGSGYDDDEDFANEWPPLVCC
FGAPRWEFVPTVRVSDRQMHPDMYSTWRHLQWEPPEFARAPGSAASNVAI
ALTRLGGRAAVLGKVGDDDFGRELVYRMNCERVQTRAVKFDGKAATATAR
MKVSFRDREDGKGGTKLVAETVKSAAEDSLRKTEINVDVLKEARMFHFNS
EVLLNPSMHDTLFRAIELSKKFGSKVFFDLNLPLPLWTSRDKTKEVINRA
WKEADIIEVSRDELEFLLDHEISFYKKLATVLPLQP*
back to top