Sh_003K10_p000140

Overview
NameSh_003K10_p000140
Unique NameSh_003K10_p000140
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length60
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003K10contigSh_003K10:100825..101004
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003K10_t000140Sh_003K10_t000140R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003K10_p000140 ID=Sh_003K10_p000140|Name=Sh_003K10_p000140|organism=R570 Sugarcane cultivar|type=polypeptide|length=60bp
MIPAATANLSCLSNVSWSSYISGQVVSFLIAAATIASPEPVRSVVYGVMS
ASSVPTTQP*
back to top