Sh_003K10_t000120

Overview
NameSh_003K10_t000120
Unique NameSh_003K10_t000120
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1011
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NotePutative Protein STRICTOSIDINE SYNTHASE-LIKE 10
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003K10contigSh_003K10:88741..89815
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_003K10_g000120Sh_003K10_g000120R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_003K10_p000120Sh_003K10_p000120R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_003K10_t000120 ID=Sh_003K10_t000120|Name=Sh_003K10_t000120|organism=R570 Sugarcane cultivar|type=mRNA|length=1011bp
ATGGGGCGTCGGAACAATCTGGCGACGACATCAAGACCACCGACACGCGC
TGGAGCTTCCACCTTCCTCTACCAAGCGGCCTCAGGGGCGCCGAGAGGCC
TCGCCTTCGACGGCAAGGGCGAGGGGCCCTACGCCGGCGTCTCAGACGGC
CGCATCCTCAAGTGGGGCGGCACCACCGTCGGCTGGACCACGTTCGCGCA
CAGCGCGAACTACCGGAAGATACCCCTATGCACGGCGGGCGTGGTGCCGT
CGGAGGAGACCGAGAGCATGTGCGGCCGCCCGCTGGGCCTCCAGTTCCAC
GGCAAGACGGGTGACCTCTACATCGCCGGCGCCTACCTGGGGCTCATGAG
GGTCGGTCCGGGCGGCGGCGAGGCCGAGGTGCTGGCGACCGGCGCGGACG
GCGTCCCGTTCAACTTCGTCAACGGCCTGGACGTCGACCAGGCCACCGGC
GACGTCTACTTCACCGACTCGAGCACGACGTATCCCAGGAGGTTTAACAC
CGAGATCATGATGAACGCGGACGCGACGGGCCGGCTTCTCAGGTACGACG
CGCAGACGAAGAGCGTCACCGTGCTGAAGGCCGGCCTGCCGTACCCGAAC
GGCGTGGCGGTCAGCCGCGACGGGGCGCAGGTCGTGGTCGCGCACACCGT
GCCTTGCCAGGCGTTCAGGTACTTTCTCCGCGGCGCCAGGGAGGGGCAGT
ACGACCTGCTGGCGGACCTTCCGGGGTACCCGGACAACGTGAGGCGGGAC
AACAAGGGTGGCTATTGGGTGGCGCTGAACCAGCAGAAGCAGCGGCTGGA
CGCGACGCCGACGACGGCTCCTGTGAAGCACCTGGTTGGCGTCCGCCTGG
ACGCTGACGGGGTGGAGGTCGAGGAGCTCACGGCGGCCAAGGGCGTCACG
CTGAGCGACGTGGCGGAGATGAAGGGGCAGCTGTGGTTAGGCTCCGTGGA
GCTCGAGTACGGCCGTGTTCAGTTCGGCCGAATCGGGAGGGGCAGATTTT
GCACAGTATAA
back to top

protein sequence of Sh_003K10_p000120

>Sh_003K10_p000120 ID=Sh_003K10_p000120|Name=Sh_003K10_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=337bp
MGRRNNLATTSRPPTRAGASTFLYQAASGAPRGLAFDGKGEGPYAGVSDG
RILKWGGTTVGWTTFAHSANYRKIPLCTAGVVPSEETESMCGRPLGLQFH
GKTGDLYIAGAYLGLMRVGPGGGEAEVLATGADGVPFNFVNGLDVDQATG
DVYFTDSSTTYPRRFNTEIMMNADATGRLLRYDAQTKSVTVLKAGLPYPN
GVAVSRDGAQVVVAHTVPCQAFRYFLRGAREGQYDLLADLPGYPDNVRRD
NKGGYWVALNQQKQRLDATPTTAPVKHLVGVRLDADGVEVEELTAAKGVT
LSDVAEMKGQLWLGSVELEYGRVQFGRIGRGRFCTV*
back to top

mRNA from alignment at Sh_003K10:88741..89815+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_003K10_t000120 ID=Sh_003K10_t000120|Name=Sh_003K10_t000120|organism=R570 Sugarcane cultivar|type=mRNA|length=1075bp|location=Sequence derived from alignment at Sh_003K10:88741..89815+ (R570 Sugarcane cultivar)
ATGGGGCGTCGGAACAATCTGGCGACGACGTGGCTCCTCGCCTTGGTCGT GCTAGCCCTATCCCTTTTCGCCGGGCCGTGTGCGGCGGCACAGATCAAGA CCACCGACACGCGCTGGAGCTTCCACCTTCCTCTACCAAGCGGCCTCAGG GGCGCCGAGAGGCCTCGCCTTCGACGGCAAGGGCGAGGGGCCCTACGCCG GCGTCTCAGACGGCCGCATCCTCAAGTGGGGCGGCACCACCGTCGGCTGG ACCACGTTCGCGCACAGCGCGAACTACCGGAAGATACCCCTATGCACGGC GGGCGTGGTGCCGTCGGAGGAGACCGAGAGCATGTGCGGCCGCCCGCTGG GCCTCCAGTTCCACGGCAAGACGGGTGACCTCTACATCGCCGGCGCCTAC CTGGGGCTCATGAGGGTCGGTCCGGGCGGCGGCGAGGCCGAGGTGCTGGC GACCGGCGCGGACGGCGTCCCGTTCAACTTCGTCAACGGCCTGGACGTCG ACCAGGCCACCGGCGACGTCTACTTCACCGACTCGAGCACGACGTATCCC AGGAGGTTTAACACCGAGATCATGATGAACGCGGACGCGACGGGCCGGCT TCTCAGGTACGACGCGCAGACGAAGAGCGTCACCGTGCTGAAGGCCGGCC TGCCGTACCCGAACGGCGTGGCGGTCAGCCGCGACGGGGCGCAGGTCGTG GTCGCGCACACCGTGCCTTGCCAGGCGTTCAGGTACTTTCTCCGCGGCGC CAGGGAGGGGCAGTACGACCTGCTGGCGGACCTTCCGGGGTACCCGGACA ACGTGAGGCGGGACAACAAGGGTGGCTATTGGGTGGCGCTGAACCAGCAG AAGCAGCGGCTGGACGCGACGCCGACGACGGCTCCTGTGAAGCACCTGGT TGGCGTCCGCCTGGACGCTGACGGGGTGGAGGTCGAGGAGCTCACGGCGG CCAAGGGCGTCACGCTGAGCGACGTGGCGGAGATGAAGGGGCAGCTGTGG TTAGGCTCCGTGGAGCTCGAGTACGGCCGTGTTCAGTTCGGCCGAATCGG GAGGGGCAGATTTTGCACAGTATAA
back to top

Coding sequence (CDS) from alignment at Sh_003K10:88741..89815+

>Sh_003K10_t000120 ID=Sh_003K10_t000120|Name=Sh_003K10_t000120|organism=R570 Sugarcane cultivar|type=CDS|length=1011bp|location=Sequence derived from alignment at Sh_003K10:88741..89815+ (R570 Sugarcane cultivar)
ATGGGGCGTCGGAACAATCTGGCGACGACATCAAGACCACCGACACGCGC
TGGAGCTTCCACCTTCCTCTACCAAGCGGCCTCAGGGGCGCCGAGAGGCC
TCGCCTTCGACGGCAAGGGCGAGGGGCCCTACGCCGGCGTCTCAGACGGC
CGCATCCTCAAGTGGGGCGGCACCACCGTCGGCTGGACCACGTTCGCGCA
CAGCGCGAACTACCGGAAGATACCCCTATGCACGGCGGGCGTGGTGCCGT
CGGAGGAGACCGAGAGCATGTGCGGCCGCCCGCTGGGCCTCCAGTTCCAC
GGCAAGACGGGTGACCTCTACATCGCCGGCGCCTACCTGGGGCTCATGAG
GGTCGGTCCGGGCGGCGGCGAGGCCGAGGTGCTGGCGACCGGCGCGGACG
GCGTCCCGTTCAACTTCGTCAACGGCCTGGACGTCGACCAGGCCACCGGC
GACGTCTACTTCACCGACTCGAGCACGACGTATCCCAGGAGGTTTAACAC
CGAGATCATGATGAACGCGGACGCGACGGGCCGGCTTCTCAGGTACGACG
CGCAGACGAAGAGCGTCACCGTGCTGAAGGCCGGCCTGCCGTACCCGAAC
GGCGTGGCGGTCAGCCGCGACGGGGCGCAGGTCGTGGTCGCGCACACCGT
GCCTTGCCAGGCGTTCAGGTACTTTCTCCGCGGCGCCAGGGAGGGGCAGT
ACGACCTGCTGGCGGACCTTCCGGGGTACCCGGACAACGTGAGGCGGGAC
AACAAGGGTGGCTATTGGGTGGCGCTGAACCAGCAGAAGCAGCGGCTGGA
CGCGACGCCGACGACGGCTCCTGTGAAGCACCTGGTTGGCGTCCGCCTGG
ACGCTGACGGGGTGGAGGTCGAGGAGCTCACGGCGGCCAAGGGCGTCACG
CTGAGCGACGTGGCGGAGATGAAGGGGCAGCTGTGGTTAGGCTCCGTGGA
GCTCGAGTACGGCCGTGTTCAGTTCGGCCGAATCGGGAGGGGCAGATTTT
GCACAGTATAA
back to top