Sh_003M06_p000010

Overview
NameSh_003M06_p000010
Unique NameSh_003M06_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length353
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR029044
InterProIPR005836
InterProIPR005835
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M06contigSh_003M06:117..3032
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003M06_t000010Sh_003M06_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003M06_p000010 ID=Sh_003M06_p000010|Name=Sh_003M06_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=353bp
MGESTCSSTYFFSSPNNKKGSSVLFLDPAQLVVYLCASAMQFSSVFPLEG
KACMSPVRRGGEGSWSERMRIGNSCSIRRNKALRRMCFGARGAVSSAQCV
LTSDAGPDTLVVRTSFRRNYADPNEVAAVILGGGTGTQLFPLTSTRATPA
VPIGGCYRLIDIPMSNCFNSGINKIFVMTQFNSASLNRHIHRTYLGGGIN
FTDGSVEVLAATQMPGEAAGWFQGTADAVRKFIWVLEDYYKHKAIEHILI
LSGDQLYRMDYMELVQKHVDDNADITLSCAPVGESRASDYGLVKFDSSGR
VIQFSEKPKGAALEEMKVDTSFLNFAIDDPTKYPYIASMGVYVFKRDVLL
DLL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008878glucose-1-phosphate adenylyltransferase activity
GO:0016779nucleotidyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:0005978glycogen biosynthetic process
GO:0009058biosynthetic process