Sh_003M06_p000040

Overview
NameSh_003M06_p000040
Unique NameSh_003M06_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length345
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.1.1.41
EC2.1.1.164
EC2.1.1.263
InterProIPR029063
InterProIPR013216
InterProIPR013705
InterProIPR030384
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M06contigSh_003M06:10096..13979
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003M06_t000040Sh_003M06_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003M06_p000040 ID=Sh_003M06_p000040|Name=Sh_003M06_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=345bp
MSKSGALDLASGLGGKITKAEVKSAVDEYEKYHGYYGGKEEARKSNYTDM
VNKYYDLATSFYEYGWGESFHFAHRWNGESLRESIKRHEHFLALQLGLKP
GMKVLDVGCGIGGPLREIARFSSTSVTGLNNNEYQITRGKELNRLAGVSA
TCDFVKADFMKMPFDDNTFDAVYAIEATCHAPDPVGCYKEIYRVLKPGQC
FAVYEWCITDHYDPNNSTHKRIKDEIELGNGLPDIRSTRQCLQAVKDAGF
EVVWDKDLAEDSPLPWYLPLDPSRFSLSSFRLTSVGRMITRTMVKALEYI
GLAPQGSERVSNFLEKAAEGLVEGGKKEIFTPMYFFLARKPLSE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008168methyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
GO:0006694steroid biosynthetic process