Sh_003M06_p000050

Overview
NameSh_003M06_p000050
Unique NameSh_003M06_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length373
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000719
InterProIPR011009
InterProIPR008271
InterProIPR017441
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M06contigSh_003M06:15577..16695
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003M06_t000050Sh_003M06_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003M06_p000050 ID=Sh_003M06_p000050|Name=Sh_003M06_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=373bp
MLAKRAAAICVLVDCDDDDPSSAGAGWCKRRRLWTTADYEATRALGEGSF
GAVVEARHRATGQAVAVKALRAPATAAPTGGGAAAEAEAKASADAVADEA
LREAEFLAACRGHPSLVGLHAIAFNPGTSEVALVMECVGPNLHDVLNGSR
HRAGRPFPEPQVRRIMRQLLAGAKHMHARKIMHRDIKPGNILVVGTGAGD
GREPVSVKICDLGLAASITDQPPYERAGTRRYMAPEMLLGKLDYDAMVDM
WSLGCVMAELLTGKPLFYGEDDNEVLRRIFSVLGMPGQRTWPAFKSLPLA
GTVVLPSVRHRNRLRQLLPKERLSADGFDVLKRLLSCNADKRPSASAALR
SPWFTKDIDSTAAAAAAAKTVQ*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation