Sh_003M06_p000060

Overview
NameSh_003M06_p000060
Unique NameSh_003M06_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1460
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001623
InterProIPR006311
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M06contigSh_003M06:33593..40396
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003M06_t000060Sh_003M06_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003M06_p000060 ID=Sh_003M06_p000060|Name=Sh_003M06_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=1460bp
MDAARRERRHHRKAAAATAAAAGAAGAGGGGGAAAAARAAYGDVFGGPPR
FAAPFGGAPLDYAEVFGGVAATCSIPYLDLPPAPASGAFFACRGKGDYGE
IFGRFDFGDFALPYEDLFGAPEPQPEPQPEAARQTDPEIASSSGSSTRSS
FKKESSQPEDEPSILPQHYQNLDHCQHFKDHKFSPISFSPDTESLQFVMS
YNKTTERRPDDLIEMTTCTAKPSLDFVIDSRNLSHDTAINHVSRIDNDTM
ANDDNNKNPSSANTSVRSPESDFAVDQKQQSPSWTPISGSMSGNENHKNS
DIHSTRSTVTPPDYAFLRVSDSDAQTQPIKVQPILSQQPKLLNKKESAAK
ECVNIVNHNCSPTSAAHTTSSSNMPHTDKRVDANPTSASAAMKEAMDFAE
ARLKAAKALLEGKGDSFKLRKKPSHLRSTRSMEIKSPIFVDVDTSEQKLS
VKKSSKEEKNPDVSLFDKHKKLSAVRLDHFDDNGKKVHPLEKPQPMLQHC
TESCQTSSKLEKLGNWKSGNDFFELSGDDQKCKTDEATEGGDKCEQTDPI
TSVINDQRETEFNAADSDLDRYEKLWEVNDGRNVGVKHVNLRENKTAPVD
KDRVSVILEPSTENMAHQKTHNSIGEGLVTLENAKESHDTDKCLELPTSG
ASTKLDVFKDVSGSLPEACSSVNASDLRDHGNISPNVSPLAGTSQEDRNS
KLAPEVSSDSGMQHTSRSNEKLQESSDVSNVAISQGSNIKSLILEELKES
DVCNTFTRGPNRIEQEAETYGREKFSFIDGSPLLPSHFHNKGAKINLVSE
KVQKVEIEKKVGPCAHPEVTIVDLDADCPKDANNDIPQNDDFADPEESNM
LNVFEVASKLIKRELDQEMHGSLGHGEEENMEEGIDAFVSDINGKEADET
ALENSEWTGTEEGSAHVNQEDQNSSGSTNRGKNDVDAKRDTTCDEVGSES
LSGDEVVIKATSDSTGEVSNRGERELPTERSCEDHRKASIMEEKDTTARI
SKTEHVPSPLETTCGVTKSAEAPTSIERENMTRADSTCEKDKGSSQRVQE
KKENERRLAKERELAEEKERRKLEKERELAEEMERMKLEKEKELAEEKER
RKLEKERELAEEKERRKLEEAERERERKKDILAVERATREAHERAFAEAR
EKAEKMALERITAARQRASAEAREKEERASVQATAERATREARIKAERAA
VERATAEARERAIEKAKAEKALAEARERRERYKSSFKESFKSTNQDIRQE
SQFQRAPSGNFIRNPDFGNRVVEVESTLRHKARLERHQRTAERVTKALAE
KNMRDLLAQREQAEKHRLSEFLDPEIKRWSNGKEGNLRALLSTLQYILGA
DSGWQPVPLTDLITAVAVKKAYRKATLCVHPDKLQQRGATIRQKYICEKV
FDLLKVCALSTLNALVIWNSIRATLSIYGCISGVSFSFSCEYFSYRTLVS
DFLNLLRTS*
back to top