Sh_003M06_p000080

Overview
NameSh_003M06_p000080
Unique NameSh_003M06_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length57
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M06contigSh_003M06:58118..58288
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003M06_t000080Sh_003M06_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003M06_p000080 ID=Sh_003M06_p000080|Name=Sh_003M06_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=57bp
MEIHFFGHRIVSIVWLKPKSLGFYRNDLFYIDLTKTNYPGEYDGTMFHFC
NEHQLR*
back to top