Sh_003M06_t000020

Overview
NameSh_003M06_t000020
Unique NameSh_003M06_t000020
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length225
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteDoubtful hypothetical protein
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M06contigSh_003M06:3162..3524
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_003M06_g000020Sh_003M06_g000020R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_003M06_p000020Sh_003M06_p000020R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_003M06_t000020 ID=Sh_003M06_t000020|Name=Sh_003M06_t000020|organism=R570 Sugarcane cultivar|type=mRNA|length=225bp
ATGCTGCTGCGCGTCAGCGCGTGCAGTTCCTTCGAACATTTTCTTCGTTC
GCTGGGTTTTGCTATGGTGGTGTGTGTGATGTTATTACCTAGTCTGGCGC
CGCCGGCAGGAGGGGCGGTGGATCAGGTGGGTGCCGGGGAGTGTGTGGCC
GCGAAGAAGGGATCAGCCCTCGGCGAGTCGAGGGAGAAGGAGGAGAGATC
CCTTACGAATTCTTCAGAGGACTGA
back to top

protein sequence of Sh_003M06_p000020

>Sh_003M06_p000020 ID=Sh_003M06_p000020|Name=Sh_003M06_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=75bp
MLLRVSACSSFEHFLRSLGFAMVVCVMLLPSLAPPAGGAVDQVGAGECVA
AKKGSALGESREKEERSLTNSSED*
back to top

mRNA from alignment at Sh_003M06:3162..3524-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_003M06_t000020 ID=Sh_003M06_t000020|Name=Sh_003M06_t000020|organism=R570 Sugarcane cultivar|type=mRNA|length=363bp|location=Sequence derived from alignment at Sh_003M06:3162..3524- (R570 Sugarcane cultivar)
GTCGTTCCTGGAATGGATGGGTGGTCCAATGGATGTGTTTTTTACTCTGA TGCTGCCCTCGACGAATGCTGCTGCGCGTCAGCGCGTGCAGTTCCTTCGA ACATTTTCTTCGTTCGCTGGGTTTTGCTATGGTGGTGTGTGTGATGTTAT TACCTAGTCTGGCGCCGCCGGCAGGAGGGGCGGTGGATCAGGTGGGTGCC GGGGAGTGTGTGGCCGCGAAGAAGGGATCAGCCCTCGGCGAGTCGAGGGA GAAGGAGGAGAGATCCCTTACGAATTCTTCAGAGGACTGACGAGGCGGCG GCGGCGGCTGGGATCGTAGTCCTGGATTTCTCGCGCTGTGTGGATGAATT TCCCTGAATTACC
back to top

Coding sequence (CDS) from alignment at Sh_003M06:3162..3524-

>Sh_003M06_t000020 ID=Sh_003M06_t000020|Name=Sh_003M06_t000020|organism=R570 Sugarcane cultivar|type=CDS|length=225bp|location=Sequence derived from alignment at Sh_003M06:3162..3524- (R570 Sugarcane cultivar)
ATGCTGCTGCGCGTCAGCGCGTGCAGTTCCTTCGAACATTTTCTTCGTTC
GCTGGGTTTTGCTATGGTGGTGTGTGTGATGTTATTACCTAGTCTGGCGC
CGCCGGCAGGAGGGGCGGTGGATCAGGTGGGTGCCGGGGAGTGTGTGGCC
GCGAAGAAGGGATCAGCCCTCGGCGAGTCGAGGGAGAAGGAGGAGAGATC
CCTTACGAATTCTTCAGAGGACTGA
back to top