Sh_003M23_p000010

Overview
NameSh_003M23_p000010
Unique NameSh_003M23_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length89
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M23contigSh_003M23:2219..2485
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003M23_t000010Sh_003M23_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003M23_p000010 ID=Sh_003M23_p000010|Name=Sh_003M23_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=89bp
MDSSSSCFVAPWIACSDGLILRKISLVFINSPLPVEHTDTPYSCSPTAKK
ELTDMRGFLFLFHQHPPPSHPNLNPHGHESDAAKIFPP*
back to top