Sh_003M23_p000030

Overview
NameSh_003M23_p000030
Unique NameSh_003M23_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length55
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M23contigSh_003M23:20030..20194
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003M23_t000030Sh_003M23_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003M23_p000030 ID=Sh_003M23_p000030|Name=Sh_003M23_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=55bp
MYCQYIDDDTFVIQIFVVLMKILICQQVSLFSFMLMSTKIKWMPNILTCY
DKKF*
back to top