Sh_003M23_p000040

Overview
NameSh_003M23_p000040
Unique NameSh_003M23_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length625
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR004813
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M23contigSh_003M23:23844..26452
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003M23_t000040Sh_003M23_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003M23_p000040 ID=Sh_003M23_p000040|Name=Sh_003M23_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=625bp
MVAALLIGFVYTVIVMKLSLTTGLTPTMNVSAALLAFLALRGWTRALERL
GIASRPFTRQENTVVQTTVVACYTIGFGGGFGSFLLGLNKKTYELSGVNT
PGNVPGSYKEPAIGWMTGFLLAVSFVGLLTLLPLRKVLVIDYKLTYPSGT
ATAVLINGFHTPQGDKNAKNQVRGFLKYFGISFLWSFFQWFYTAGDNCGF
AQFPTFGLQAFKQTFFFDFSLTYVGAGMICSHLVNLSLLFGAILSWGVMW
PLISKQKGNWYSANASQSSMSGIYGYKAFLCIALLVGDGLYNFVKVIAIT
VKNIRERSRRKNQNKVADADTMALDDMQRDEVFSRDNIPTWLSYTGYAAL
SLIAVIVIPIMFREVKWYYVILAYLLAPALGFCNAYGTGLTDMNMGYNYG
KIALFVLAAWAGKDNGVVAGLVGCGLVKQLVLVSADLMHDFKTGHLTLTS
PRSMLVGQAVGTLMGCVLAPLTFMLFYRAFDVGDPDGYWKAPYALIYRNM
AILGVEGFSALPTHCLELCAGFFAFAVLANLARDLLPRRIARFVPLPMAM
AVPFLVGASFAIDMCVGSLVVFAWHKLDSKKAALLVPAVASGLICGDGIW
TFPSSLLALAKIKPPMCMKFTSGS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport