Sh_003M23_p000050

Overview
NameSh_003M23_p000050
Unique NameSh_003M23_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length787
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR003656
InterProIPR007021
InterProIPR012337
InterProIPR008906
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M23contigSh_003M23:31034..33691
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003M23_t000050Sh_003M23_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003M23_p000050 ID=Sh_003M23_p000050|Name=Sh_003M23_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=787bp
MSSAGSTRASVDQPEPARAPALKRNPDDVGWEYGVLIDPNDLNVIKCKLC
PKVVKAGIYRLKLHICDKKGDVRACPNATEEDKAKCRKAIEESGRAKRAR
REKEQEVRDAITIDVESDAEPEEKTGLDEIGGSGSRVMGPMDNFTKPMDS
SSLAKGKKLHQLNISEHVKKERLHRFKRYVARWLYVRRVPFNAINNTEFD
QMIEAAGRFGPGAKKPYQHELREKLLQEEVQDTKEMLKAHEKEWSKNGCS
IMTDAWTDQKRRSIMNMCVNCSIGTSFLESKEVSAESHTGELIFQYVNSC
IDKVGADNIVQVVTDNASNNMAAKDLLSIERPQIFWTSCATHTINLMLEA
MGKMKKFKTTIEQAKALTIFIYAHHRTLALMRKFTKKREIVRPGVTRFAS
NFLTLQSLFEKKEQLRKMSQSKEWEKISHVKSAKGVQATATLVRPNFWSS
VALWLRVFEPLVKVLRMVDGDMKPSMAFLYGEILKAKGDIKVAIGNIPGA
AGLYSSIMQIIDVKMKNRLDSPLHKAAYFLNPYYSYNDDSIFQSEEVMDG
FLTAIETFYHGDYDKQAQVLNEEVHRFKDRVGHFGKQVAAAGCKDFDMNP
AKWWGNYGTQVPVLQKMAIRILSLTSSASGCERNWSCHEGIHTKRRNRLT
YERLEQLVFVQFNALHAQKKDKAKKNQKVDPLLATEATYAQGWIVEGGEE
DEINDVDPVTGLTWQLIAETCGAEEVTLLRRSARLNQPREIEEDIYSEPE
PEDDHIDEEEIEFESDQEDVVTAGYEAEEGAGTSDD*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
GO:0046983protein dimerization activity