Sh_003M23_p000060

Overview
NameSh_003M23_p000060
Unique NameSh_003M23_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length125
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000772
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M23contigSh_003M23:54741..55115
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003M23_t000060Sh_003M23_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003M23_p000060 ID=Sh_003M23_p000060|Name=Sh_003M23_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=125bp
MWRPSSTRSGRQSHPVQLVPYNPDFLDESRIWMESRNVGNGFRCVHMVNS
MYLNFDALHGIYGDTDVVLWKWCEGDNQRWNSEDPALLLDLTSIRSIETR
REFRSEGTRSWTTKERRMATEPRG*
back to top