Sh_003M23_p000090

Overview
NameSh_003M23_p000090
Unique NameSh_003M23_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length453
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR011009
InterProIPR001245
InterProIPR000719
InterProIPR008271
InterProIPR017441
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_003M23contigSh_003M23:64701..66385
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_003M23_t000090Sh_003M23_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_003M23_p000090 ID=Sh_003M23_p000090|Name=Sh_003M23_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=453bp
MAPAPAPAALSSTISTEARSLASAAAASCASFASSSANVSEASGARPAAS
GSSGSGSASSARSIPELYEERGALREFGLRELRAATRDFSPLLMVGEGGF
GCVYRGVLRLSGGGPGDTPVAVKRLNPNGGQGHKEWLAEVHFLGVVEHRN
LVRLIGYCASQTDRGPQRLLVYEFIPNKTLDDHLFNRAYPVLPWEVRLQI
ALGAAEGLLYLHEGLELQIIYRDFKASNVLLDEEFRPKLSDFGLAREGPS
EGQTHVSTAVMGTFGYAAPDYVQTGHLTTKSDVWSFGVVLYEILTARRSI
ERNRPRNEQKLLEWVRRHPPESEQFAAIMDARLQGRYPMRGATEVARLAN
GCLAKHAKDRPTMREVIEGPRQATRHTEMDGVVVVVGAAAECQGSPPRAP
GAEDASAVAVAAQARKRRMLHLAALGGAAADAHARRRLMLMRAAATAAAA
PT*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation